KEGG   Meleagris gallopavo (turkey): 100551010Help
Entry
100551010         CDS       T01523                                 

Definition
uricase-like
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100551010
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    100551010
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     100551010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 332 aa AA seqDB search
MPLPSSITIIACVFSLQIKDIEVLNCEYGKNTIKFLRLHREGKKHFIKEVEVCTHLRLTS
AYEYLDGNNSFVIPTDTIKNIVLVLAKKKGISSIEQFAIDICKHFMTTFCQVEYVKTYIQ
EVPWQRQYQNGVPHIHSFILVPDGIRFCEAEQCRNGPLVVFAGIKDLKLMKTTQSGFEGF
YRNEHTTLPERNDRILCGELFCKWSYGECGDFDFDCIWAKVRKCILEAFSGPPDCGEYSP
SYQKTVNCIQMRVLSQVSQVQVIEVILNNIFYDVVDMKALGCTNDKEVLLPVETPYGFCA
CTLGRKKYLEAQSHMIKDEKQRQFGLVAAQGK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgccaagttctattacaattatagcatgtgtgttttcccttcagattaaggat
atagaagtgctcaactgtgaatatggcaagaacacaatcaagttccttcgccttcataga
gaagggaagaagcatttcattaaagaagtggaagtgtgcacacatctccggctgacttct
gcttatgagtatttggatggaaacaactctttcgtgataccgacagacaccattaagaat
attgtcctggtgttggccaaaaaaaaagggatctcaagtatagaacaatttgctatagat
atctgcaaacacttcatgacaacattttgccaagtggagtacgtcaaaacctacattcag
gaagtgccatggcaacgtcaataccagaacggtgttccccacatccactcattcatactt
gttcctgatgggattcgcttttgtgaagctgagcagtgccggaatggtcctctggttgtt
tttgctggaattaaagatctgaaacttatgaagacaacacagtctggatttgaaggcttc
tatagaaatgaacacaccacacttcctgaaaggaacgataggattttatgtggagagctc
ttctgcaagtggtcatacggcgaatgcggagattttgactttgactgcatatgggccaaa
gtccggaaatgcattcttgaggccttctcaggcccacctgactgtggagagtattcaccc
tcttaccagaaaactgtcaactgcatccagatgcgtgtcctttcccaagtgtcacaggta
caggtcatagaagtcatcctgaacaacattttttacgatgtggtagacatgaaggcacta
ggctgtacaaatgacaaagaagttctgcttccagtggaaactccctatggtttctgtgct
tgcacacttggcagaaagaagtacttggaagcacaaagccacatgataaaggatgagaag
caaaggcagtttggactggtagctgctcagggaaagtaa

DBGET integrated database retrieval system