KEGG   Meleagris gallopavo (turkey): 100551164Help
Entry
100551164         CDS       T01523                                 

Gene name
EHHADH
Definition
enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase
Orthology
K07514  
enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
PPAR signaling pathway
Peroxisome
Module
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:mgp01200]
Metabolism; Overview; Fatty acid metabolism [PATH:mgp01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mgp00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mgp00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:mgp00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:mgp00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:mgp00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:mgp00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:mgp00410]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:mgp04146]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:mgp03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 726 aa AA seqDB search
MVESCMKREEIFLQVECHVVKPVVCLAVLQALEDGLKRADADPSVKAVTICGENGKFSAG
ADIRGFSSPNKQGLGLGPIVSLIERSEKPVVAAIEGIALGGGLEVTLGCHYRIAHVQARM
GLPEVTIGLLPGAEGTQRLPRLIGVPAALDIITTGRHISASEALKLGLVDEVVEENTVEA
AIRLANRLIGQPLGHRRLSLKPVPKLPNMEAFLTEALVKVKKRAQGCLAPELCFQAIKAA
TEQPFADGVRKERELFNILLTSGQAKALQYAFFAERAVEKWTTPSGASWKTASPQPIRKA
AVIGLGTMGRGIVTSLVKAKIPVVALEQDLEYLNTGRKAVMLLLEREAMKMEQGGQTLDF
NNPARLQFAVDFDVLRDVDLVIEAVFENMALKKEIFNKLSRICKPEAFLCTNTSALNIDE
IASVTSRPQQVIGTHFFSPAHVMRLLEIIYGRHTSPTTIATAMQLAKVMKKVGVVVGNCF
GFVGNRMMFPYVQQAVFLLEEGSRPEDVDQVLEDFGFKIGPFRMSDLAGLDVGWRSRKDQ
GLTGPTLAPGTSARQRHGYRYSPLPDLLCEKGRFGQKTGKGWYQYEKAGGRTAKPDPWIH
SFLSEYRDTHQIKTRFIDQEEILERCLFTLINEGFDILAEGIASGPEHLDVVYINGYGWP
KHRGGPMFYASTVGLPNILAKLQKYSEIHPDVPQLRPSAFLKKLVAMGNPPLNDWMSYLH
RQSNKL
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaagctgtatgaagagagaagaaatatttttgcaagtagagtgtcacgtggtg
aaaccagttgtgtgtttggcagttctccaggcgctagaggatggactgaaaagagcagat
gcagatccttcggtgaaagctgttacaatttgtggtgaaaatgggaagttcagtgcaggc
gctgatattcgaggattttcttctccaaataaacagggtcttggcttgggccccatagtt
tctctcatagaaaggagcgagaagcctgttgtggctgccattgaaggcattgccttggga
ggaggcctggaggtgacacttggttgtcactatcgtatcgcacacgtgcaggcacggatg
ggtttaccagaagtcacaattgggttgcttccaggtgctgaaggcactcagcggctcccc
agactgattggggttcctgctgccctggatataattactacaggaagacacatttctgca
tctgaagcactgaagctgggcttggttgatgaagttgtggaggagaatacagtcgaagca
gcaatccgtttggcaaacaggttgatcggccagcccttgggacaccgcaggctcagcctg
aagccagtccccaaattgcccaacatggaagcatttctcactgaggctcttgtgaaggtg
aagaaacgggcccaagggtgcctggcaccagaactgtgcttccaagcaatcaaagctgcc
acagagcagccatttgcagatggagtccggaaggagagagagctgtttaacatcctgctg
acttcaggccaggccaaagcactgcagtatgctttctttgcagagagagcagtggagaag
tggacaacacccagtggagcttcatggaaaactgcttcccctcagcccatccgcaaagca
gctgtgatagggctgggaacaatgggccgaggcattgtgacttctctggttaaggccaag
atacctgtggtagccctggagcaggatctggagtatctgaacacaggaagaaaagccgtg
atgctccttttggaacgtgaggctatgaaaatggagcagggtggccaaaccctggatttc
aataaccctgcacgactccagttcgctgtggactttgatgtgttgcgggatgtagatcta
gttattgaagctgtgtttgagaacatggcactaaagaaggaaatattcaacaagctatca
agaatctgcaagccagaggcctttctgtgtacaaacacatcagccctgaatatcgatgaa
atagcttctgtcaccagccgcccacagcaggtcattggcacgcacttcttctcccctgct
catgtgatgaggctgttagaaataatctatggccgtcacacgtcccccaccaccattgcc
acggccatgcagctagccaaagtgatgaagaaagttggagtggtggtagggaactgtttt
gggtttgttgggaaccgaatgatgtttccttatgtacaacaggcagttttcctcttagag
gaaggaagcagaccagaagacgtagatcaggttcttgaagattttgggtttaagataggg
cctttccgaatgtctgatcttgctgggctggatgtgggctggaggtctcgaaaggaccag
ggcctcactgggcccacactggctccaggaacatctgcccgccagcggcatggctatcgc
tacagcccgctgcctgaccttctgtgtgagaaaggcaggtttggccagaagactggaaaa
ggctggtatcagtacgagaaggctgggggtaggacagccaaaccagacccgtggattcac
agctttctgtctgagtacagggacacccatcaaatcaaaacccgctttatagaccaggag
gaaatcctggagcgttgcttgtttactcttatcaatgaaggatttgacatcctggctgag
ggaatagcgtcaggcccagaacaccttgatgtagtttatatcaatggttacggatggccg
aagcacaggggtggccccatgttctatgcttccactgttgggctccctaacattctggct
aagctgcagaaatactctgagatccaccctgatgttccccagctacgtcccagtgccttt
ctgaaaaagttggtggctatggggaaccctcctctcaatgactggatgtcctacctacac
aggcagagcaacaagctgtga

DBGET integrated database retrieval system