KEGG   Meleagris gallopavo (turkey): 100551164Help
Entry
100551164         CDS       T01523                                 

Gene name
EHHADH
Definition
enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase
Orthology
K07514  
enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
PPAR signaling pathway
Peroxisome
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100551164 (EHHADH)
   01212 Fatty acid metabolism
    100551164 (EHHADH)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100551164 (EHHADH)
   00650 Butanoate metabolism
    100551164 (EHHADH)
  Lipid metabolism
   00071 Fatty acid degradation
    100551164 (EHHADH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100551164 (EHHADH)
   00310 Lysine degradation
    100551164 (EHHADH)
   00380 Tryptophan metabolism
    100551164 (EHHADH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100551164 (EHHADH)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100551164 (EHHADH)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100551164 (EHHADH)
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     100551164 (EHHADH)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100551164 (EHHADH)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     100551164 (EHHADH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 715 aa AA seqDB search
CSWLLATESLIYFSLAVLQALEDGLKRADADPSVKAVTICGENGKFSAGADIRGFSSPNK
QGLGLGPIVSLIERSEKPVVAAIEGIALGGGLEVTLGCHYRIAHVQARMGLPEVTIGLLP
GAEGTQRLPRLIGVPAALDIITTGRHISASEALKLGLVDEVVEENTVEAAIRLANRLIGQ
PLGHRRLSLKPVPKLPNMEAFLTEALVKVKKRAQGCLAPELCFQAIKAATEQPFADGVRK
ERELFNILLTSGQAKALQYAFFAERAVEKWTTPSGASWKTASPQPIRKAAVIGLGTMGRG
IVTSLVKAKIPVVALEQDLEYLNTGRKAVMLLLEREAMKMEQGGQTLDFNNPARLQFAVD
FDVLRDVDLVIEAVFENMALKKEIFNKLSRICKPEAFLCTNTSALNIDEIASVTSRPQQV
IGTHFFSPAHVMRLLEIIYGRHTSPTTIATAMQLAKVMKKVGVVVGNCFGFVGNRMMFPY
VQQAVFLLEEGSRPEDVDQVLEDFGFKIGPFRMSDLAGLDVGWRSRKDQGLTGPTLAPGT
SARQRHGYRYSPLPDLLCEKGRFGQKTGKGWYQYEKAGGRTAKPDPWIHSFLSEYRDTHQ
IKTRFIDQEEILERCLFTLINEGFDILAEGIASGPEHLDVVYINGYGWPKHRGGPMFYAS
TVGLPNILAKLQKYSEIHPDVPQLRPSAFLKKLVAMGNPPLNDWMSYLHRQSNKL
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
tgtagttggttgttagccactgaatctctaatttatttcagtttggcagttctccaggcg
ctagaggatggactgaaaagagcagatgcagatccttcggtgaaagctgttacaatttgt
ggtgaaaatgggaagttcagtgcaggcgctgatattcgaggattttcttctccaaataaa
cagggtcttggcttgggccccatagtttctctcatagaaaggagcgagaagcctgttgtg
gctgccattgaaggcattgccttgggaggaggcctggaggtgacacttggttgtcactat
cgtatcgcacacgtgcaggcacggatgggtttaccagaagtcacaattgggttgcttcca
ggtgctgaaggcactcagcggctccccagactgattggggttcctgctgccctggatata
attactacaggaagacacatttctgcatctgaagcactgaagctgggcttggttgatgaa
gttgtggaggagaatacagtcgaagcagcaatccgtttggcaaacaggttgatcggccag
cccttgggacaccgcaggctcagcctgaagccagtccccaaattgcccaacatggaagca
tttctcactgaggctcttgtgaaggtgaagaaacgggcccaagggtgcctggcaccagaa
ctgtgcttccaagcaatcaaagctgccacagagcagccatttgcagatggagtccggaag
gagagagagctgtttaacatcctgctgacttcaggccaggccaaagcactgcagtatgct
ttctttgcagagagagcagtggagaagtggacaacacccagtggagcttcatggaaaact
gcttcccctcagcccatccgcaaagcagctgtgatagggctgggaacaatgggccgaggc
attgtgacttctctggttaaggccaagatacctgtggtagccctggagcaggatctggag
tatctgaacacaggaagaaaagccgtgatgctccttttggaacgtgaggctatgaaaatg
gagcagggtggccaaaccctggatttcaataaccctgcacgactccagttcgctgtggac
tttgatgtgttgcgggatgtagatctagttattgaagctgtgtttgagaacatggcacta
aagaaggaaatattcaacaagctatcaagaatctgcaagccagaggcctttctgtgtaca
aacacatcagccctgaatatcgatgaaatagcttctgtcaccagccgcccacagcaggtc
attggcacgcacttcttctcccctgctcatgtgatgaggctgttagaaataatctatggc
cgtcacacgtcccccaccaccattgccacggccatgcagctagccaaagtgatgaagaaa
gttggagtggtggtagggaactgttttgggtttgttgggaaccgaatgatgtttccttat
gtacaacaggcagttttcctcttagaggaaggaagcagaccagaagacgtagatcaggtt
cttgaagattttgggtttaagatagggcctttccgaatgtctgatcttgctgggctggat
gtgggctggaggtctcgaaaggaccagggcctcactgggcccacactggctccaggaaca
tctgcccgccagcggcatggctatcgctacagcccgctgcctgaccttctgtgtgagaaa
ggcaggtttggccagaagactggaaaaggctggtatcagtacgagaaggctgggggtagg
acagccaaaccagacccgtggattcacagctttctgtctgagtacagggacacccatcaa
atcaaaacccgctttatagaccaggaggaaatcctggagcgttgcttgtttactcttatc
aatgaaggatttgacatcctggctgagggaatagcgtcaggcccagaacaccttgatgta
gtttatatcaatggttacggatggccgaagcacaggggtggccccatgttctatgcttcc
actgttgggctccctaacattctggctaagctgcagaaatactctgagatccaccctgat
gttccccagctacgtcccagtgcctttctgaaaaagttggtggctatggggaaccctcct
ctcaatgactggatgtcctacctacacaggcagagcaacaagctgtga

DBGET integrated database retrieval system