KEGG   Meleagris gallopavo (turkey): 100551259Help
Entry
100551259         CDS       T01523                                 

Gene name
ASPG
Definition
(RefSeq) asparaginase
  KO
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100551259 (ASPG)
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     100551259 (ASPG)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     100551259 (ASPG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 570 aa AA seqDB search
PPFWCYSLPSILYLLHLFFFFFFPGLAPEANKLVSSLKTMPMLHDDAYAQETKLCNLHEF
PDDTLVLPVSKQNKRIFYTILELSPLLDSSNMTPEDWAKIAKKLEEHYEKYDGFVILHGT
DTMAYTASALSFMCENLGKTVVLTGSQVPIYELQNDGRANLLGALLFAGQFVIPEVCLYF
YNKLYRGNRVTKVDAGSFNAFSSPNLPPLANAEVDITINWETVWRANTKKKFRVHTNMNR
NVGLLRIFPGITAAAVKAFLQPPIEGIVLETYGSGNAPNSREDLLEELKRATERKVVILN
CTQCLRGSVKTVYATGQTLADVGVIPGCDMTPEAALTKLSYALSKSELSWEEKRQMLSEN
LRGEMTVVPTGAKISLRDSKFIQVIARSLSISCKEELEAVRDALIPPLACAAAKLGDIDA
LRAIAEMGGNLSCEDYDGRTPLHVAASEGHLPLVEYLLTSGATVYARDRYGSTPLMNAIK
FRHIQVINLLRETGAHLSSQDLENTGTILCSLAAKGDVDGLYAWYLAGADLEQTGYDGKN
ALQVAKATGHKEVLDFLRQKQQKKESFANE
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
ccccccttttggtgctactcactaccttccatcctttatttacttcatttattctttttt
tttttttttccaggacttgctcctgaggccaataagttagtaagcagcttgaagacgatg
ccaatgctgcatgatgatgcatatgcccaggaaacaaaactgtgcaacctccatgaattt
ccggatgacacattggtgctccctgtctctaagcaaaacaaaagaattttctacacaatc
ctggagctgtcaccactacttgattcttcaaacatgacaccggaggattgggccaaaatt
gcaaagaaacttgaggagcactatgaaaagtatgatggctttgtgatcctccatggcact
gatacaatggcatacacagcttcagccttatccttcatgtgtgagaacctgggtaaaaca
gttgttctgacaggatcgcaggtgcctatatatgagttgcagaatgatggccgagccaac
cttctgggagcactgctttttgctgggcagttcgtgattcccgaggtgtgcctgtatttt
tataataaactgtacaggggaaatagggtgactaaggtggatgctgggagtttcaatgcc
ttttcctcacctaacctgcctccacttgcaaatgctgaggttgatattacaataaactgg
gaaacagtatggagagccaataccaaaaagaaatttcgagttcataccaatatgaacagg
aatgttgggcttctgcgaatattcccaggaataactgctgctgctgtgaaagcatttctc
cagcctccaatcgaaggtattgtacttgaaacttatggaagtggcaatgccccaaatagc
agagaagacttgctagaagaacttaagagagcaactgaacgaaaagtagtgattctaaac
tgtacccagtgcttgcgagggtctgttaaaacagtctatgcaacagggcagactctcgct
gatgttggagtaattcctggatgtgatatgacaccagaggcagccttaactaaactgtca
tatgcgctcagcaagagtgagcttagctgggaggagaagagacagatgctgagtgagaat
ctaagaggagaaatgactgttgtacccacaggagccaagatctctctcagagatagcaag
tttattcaagtgattgccagatctctaagtatcagctgcaaggaggaattagaagctgta
agagatgcattaattccacctttggcttgtgctgcagctaaactgggtgacatagacgca
ctgagagccatagcagaaatgggtggaaacctaagctgtgaagactatgatggccgaact
ccacttcatgttgcagcctctgaagggcatttaccattagttgagtatttgttaacatct
ggtgcaactgtttacgctagagacagatatggatctaccccactgatgaacgcgatcaag
ttcaggcacatacaggtgatcaatttattaagagaaacaggagcacatctttcaagccag
gacttggagaacactggaacaatactttgcagccttgcagctaaaggtgatgtggatggg
ctgtacgcctggtacctggctggtgcagacctggagcaaactggttatgatggcaagaac
gccctacaagtagcaaaggctacagggcataaggaggttcttgacttcctcagacaaaag
caacaaaagaaggaaagttttgcgaacgagtga

DBGET integrated database retrieval system