KEGG   Meleagris gallopavo (turkey): 100551267Help
Entry
100551267         CDS       T01523                                 

Gene name
AGL
Definition
amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100551267 (AGL)
Enzymes [BR:mgp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     100551267 (AGL)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     100551267 (AGL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 1530 aa AA seqDB search
LNEMEKLDKTLFRLEQGFELQFRLGPTLQGKHVTVCTNYPASGDVFDRHKFRTLSWHNPT
GKEDDSDKYCKLDLQISGSYQYYFSLGNEKSGGGYIVVDPILRVGADNHVLPLDCVTLQT
FLAKCLGPFHEWENRLKVAKETGYNMIHFTPLQKLGLSRSCYSLADQLEVNPEFSSHNKK
CTWNDIGALVEKMKNEWNMLCITDVVYNHTAANSEWLRMHPECGYNLVNSPHLKPAWVLD
RALWHLSCMVADGRCIDKGVPPMIENDHHLNCIRKIIWEDIYPKIKLWEFFQVDVNKAVQ
QFRTLLTKGKGRVCTKSDPNQHLQIVQDPDYRRFGCTVDMNIALATFIPHSNGPGAIEEC
CNWFRKRIEELNAEQYRQIHHHQEQAVNCLAGTVVYERLAGHGPKLGPISRKYPLVTRYF
TYPFKDLTVEEEQSMMHQPDKACYFMAHNGWVMGDDPLRNFAEPGSNVYLRRELICWGDS
VKLRYGNKPEDCPYLWAHMKKYTEITAKHFHGIRLDNCHSTPIHVAEEMLATARSVRPNL
YVIAELFTGSEYIDNVFVNRLGITSLIREAMTAYNSHEEGRLVYRFGGEPVGSFVQPRLR
PLVPGIAHALFMDITHDNECPIQHRSAYDALPSAMIVSMACCATGSTKGYDELVPHQISV
VSEERFYSTWNPQAHLNSGEVNFQTGILAGRLAMNRLHQELGTKGFNQVYVDQVDEDIVA
VTRHCPNTHQSVVAVSRTAFRDPKTSFYSKEVPEMCIPGKIEEVVFEARTIERSTSPYKK
DEHFINGLPNFTVELREHIQIKESKIIKQAGTAIKGPNEFVQEIEFENLTPGSVIVFRVS
LDPKAQEAVGVLRNHLIQFSPHFKSGSLPDDHSAPILKTLFSSIASKLTLADLNQVLYRC
ESEEQEDGGGCYNIPNWSSLKYAGLQGLMSVMADVRPKNDLGHPFCDNLRSGDWMIDYVS
NRLISRAGACAEVGKWLKAMFVYLKKIPRYLIPCYFDAILVGAYTTLLDVGWHQMSSFVQ
NGSTFVKHLSLGSIQMCGIGKYACLPDLSPSLHDVPYRLNEITNKKEQCCVTLAAGLPHF
SSGIFRSWGRDTFIALRGLMLLTGRYIEARNIILAFGGTLRHGLIPNLLGQGTHARYNCR
DAVWWWLQCIQDYCKIVPNGLDILRCPVSRMYPRDDSSPQPAGSVDQPLYEVIQEAMQRH
MEGISFRERNAGPQIDQNMRDEGXXXXXXXXCFNIIAGVDHETGFVFGGNRFNCGTWMDK
MGESDRARNKGIPATPRDGSAVEIVGLCKSAVRWLLDLSRKNEYPFHGVTIKRYGREETI
TYDEWNRKIQGHFERLFFVSENPADQNEKHPNLVHKRGIYKDSYGASSPWCDYQLRPNFT
IAMVVAPELFTPERAWKALRIAEEKLLGPLGMKTLDPDDMVYCGVYDNALDNDNYNVARG
FNYHQGPEWLWPIGYFLRAKLYFSKLIGPEIYAKTVVMIKNVLSRHYVHLERSSWKGLPE
LTNENGQYCPFSCETQAWSIGVILEVLYDL
NT seq 4593 nt NT seq  +upstreamnt  +downstreamnt
ctcaacgagatggagaagctggataagaccctcttcaggctggagcaagggtttgaactg
cagtttcgattgggcccaactcttcaaggcaagcatgttactgtgtgtacaaattatcca
gcttctggagacgtatttgatcgccacaagttcagaacgttatcatggcacaatcccaca
ggaaaagaggatgactctgacaaatattgcaagttagatctccaaatttctgggtcgtat
cagtactattttagtcttggaaatgagaaaagtggtggaggttacatagttgtggatcct
attttgcgtgttggagccgataaccacgtgttacctttggactgtgttacactccagaca
ttcctcgctaagtgtctgggaccattccatgaatgggaaaatagacttaaagttgcaaaa
gaaacaggttacaacatgattcattttacaccactgcagaagcttggactatctagatca
tgctattcactggctgatcagttagaagttaatcctgaattttcaagccataacaaaaaa
tgcacttggaatgatataggagctcttgtggaaaaaatgaaaaatgaatggaatatgctt
tgcatcacagatgtagtctacaaccatactgctgctaacagtgagtggctcaggatgcat
ccagaatgtggctacaaccttgtaaattctcctcacctgaagccagcctgggtcttagat
agagctctgtggcacctgagctgtatggtggctgatggaaggtgtattgataaaggagtc
cctcccatgatagaaaatgatcatcacctgaattgtatccgtaaaatcatttgggaagat
atatatccaaaaattaaactatgggaatttttccaagtggatgttaataaagctgtgcag
caatttagaacccttctaactaaaggtaaaggaagagtgtgcactaagtctgatccgaat
caacatcttcaaatagttcaagaccctgattatagaagatttggttgtactgtagacatg
aatatagcactggcaacgttcataccacacagcaatggaccgggtgcaatagaagaatgt
tgtaactggtttcgcaagagaattgaagaactgaatgctgagcaatacagacagattcat
catcatcaagagcaggctgtcaactgtcttgcaggaacagtggtatatgaacgtctggcc
ggtcatggtcctaaactaggccctattagtagaaaatatcctttagttaccaggtatttt
acttatccattcaaagacctgactgtggaggaagaacaaagtatgatgcatcagccagat
aaagcttgttatttcatggcccataacggatgggttatgggtgatgatcctcttagaaac
tttgcagaaccaggttcaaatgtttatttgagaagagagcttatttgttggggagacagt
gtgaaactgcggtatggcaacaaacccgaagactgcccgtacctctgggcacatatgaaa
aaatacacagaaatcactgccaaacatttccatggtattcgtcttgacaactgtcactct
acacctattcatgtagctgaggagatgctagctacagccagatcagtcagacctaatctt
tatgtgatagctgaactcttcacgggcagtgagtacattgacaatgtttttgtcaaccgc
ctgggaattaccagcctgattagagaggccatgacagcttataatagccacgaagaggga
aggttggtttatcgttttggaggtgaacctgttggctcttttgttcagccacgtttgcgg
cctttggtgccaggaatagcgcatgcgctcttcatggatattacacatgacaatgagtgt
ccaattcagcatcgatctgcatatgatgcacttccaagtgcaatgattgtttccatggcg
tgttgtgctacaggaagcaccaaaggttatgatgaactagtaccccaccagatttctgta
gtatctgaagagagattttattcaacctggaatccacaagcacacctgaattctggtgaa
gttaatttccagacaggaattctagctggaaggctagccatgaacagactgcatcaggag
ctgggaactaaaggcttcaatcaggtgtatgtagatcaagttgatgaagatatagtagca
gtgacaagacattgccctaacacccaccagtctgttgtggctgtaagcagaactgctttc
agggatccaaagacttccttctacagtaaagaagtacctgaaatgtgtatcccaggaaaa
attgaagaagtagtatttgaggctagaactattgagagaagtactagtccttacaaaaaa
gatgaacattttataaatggattgcctaatttcacagtggaactcagagagcatatccag
attaaagagagtaaaatcataaagcaagctggaactgccataaaagggccaaatgaattt
gttcaagaaatagaatttgaaaatttaacaccaggaagtgtaatagtattcagagttagt
cttgatccaaaggcacaggaggctgttggtgtacttcgcaatcatctgattcagttcagt
cctcactttaaatctgggagtcttcctgatgatcattcagcacctatattaaaaacatta
ttttcttcaattgcatctaaactaactttggctgacttaaatcaagtgctgtataggtgt
gagtcagaagaacaagaagatggtggaggttgttacaatataccaaactggtcatccctg
aagtatgcaggtctccaagggttaatgtcagtaatggcagacgttagaccaaagaatgat
ttgggacacccgttctgtgataatttaagatctggagactggatgatcgattatgtcagt
aatcgtctgatttcacgtgcaggagcctgtgcagaagttggtaaatggttgaaggccatg
tttgtatatttgaagaaaattccacgctaccttattccatgttactttgatgccatttta
gtgggtgcatacacaactcttctggatgtgggatggcatcagatgtctagctttgtgcag
aatggatcaacatttgttaaacacctttccttgggctcaatccagatgtgtgggatagga
aaatatgcatgtctgccagatctgtctccttccttacatgatgttccctataggctgaat
gagattacaaataagaaggaacagtgctgtgttactttagcagctggtttacctcacttc
tcttctggaatcttccgttcttggggaagggacacctttattgcacttagaggcctaatg
ttacttacgggacgttatatagaagcaagaaacataattctagcatttggtggaacttta
agacatggtctcattcccaacctgcttggccaaggaacacatgccagatacaactgccgt
gatgctgtgtggtggtggcttcagtgtatccaggactactgtaagattgttccaaatgga
ttagacattctcaggtgtcctgtttctcggatgtatccaagagatgattcttctccacag
cctgcaggcagtgtggatcagccactctatgaagtaatacaggaggcaatgcaacgacat
atggaaggcataagtttcagagaaagaaatgctggtccacagatagaccaaaacatgaga
gacgaaggnnnnnnnnnnnnnnnnnnnnnnnngtgttttaatataatagcaggtgttgac
catgaaactggctttgtctttggggggaaccgcttcaattgtggcacttggatggataaa
atgggagagagtgacagagctcgcaacaaaggaattcctgctactccaagagatggctct
gctgtggagattgttggcctgtgcaagtcggctgttcggtggttgctggatttatctagg
aaaaatgaatatccgttccatggcgtcaccataaaaagatacggaagggaggagactatc
acatatgatgaatggaacagaaaaattcaaggacactttgaaagactcttctttgtctct
gagaaccctgcagatcaaaatgaaaaacatccaaatctagttcacaaacgtgggatttat
aaagacagctacggagcttcaagtccatggtgtgattaccaacttaggccaaattttacc
atagcaatggttgtggcccctgagttgttcacacctgagagagcttggaaagctctgagg
atagcagaggaaaaactacttggtccattgggcatgaaaactttagatccagatgatatg
gtgtactgtggagtatatgataatgctcttgacaatgacaactataatgtagccagaggt
tttaattaccaccaaggacctgaatggctgtggccgattggatattttcttcgtgccaaa
ttgtacttctcaaagttgattggtccagagatatatgcaaaaactgtggttatgataaag
aatgttctttctcgccactatgttcaccttgaaagatcatcctggaaagggcttccagaa
ttgaccaatgaaaatgggcagtattgtccttttagctgtgaaactcaggcctggtcgatt
ggtgttatccttgaagttctttatgacttgtag

DBGET integrated database retrieval system