KEGG   Meleagris gallopavo (turkey): 100551300Help
Entry
100551300         CDS       T01523                                 

Definition
inositol monophosphatase 3-like
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100551300
  Energy metabolism
   00920 Sulfur metabolism
    100551300
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    100551300
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     100551300
    3.1.3.25  inositol-phosphate phosphatase
     100551300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 277 aa AA seqDB search
MMLSQGQKAPQLAAGCSGAAQDPGKCRMKLAVPQDFMEPSWPPFSLWLINSEERVDTTDQ
ETVSWDRNIPEDIKEKIQPKEVPAESVTVWIDPLDATQEYTEDLRQYVTTMVCVAVNGKP
VIGVIHKPFSAYTAWAMVDGGSNVKARSFYNEKTPRIIVSRSHAGKVEQVARQTFGNKTV
IIPAGGAGYKVLALLDVAEKNQEEADVYIHVTYIKKWDICAGNAVLRALGGHMTTLTGEE
ISYTGSDGNEGGLIASINMDHKALIEKLPDLEKTSHK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgagccagggccagaaagcgcctcagctcgctgctggctgcagtggagcagca
caagaccctggcaagtgccgcatgaaactggctgtgcctcaagacttcatggagcccagc
tggcctccattttctctctggcttataaactctgaggaacgtgttgatacaactgatcag
gagacagtctcttgggatcgcaatattcctgaagatataaaagaaaaaatacagcctaaa
gaggttccagcagaaagtgttactgtctggattgatccattagacgctacacaagagtac
acagaggatcttcggcagtatgtcacaacaatggtttgtgtggctgtaaatgggaaacca
gtaataggagtgatacataagccattctcagcatatacagcctgggcaatggtggatggt
gggtcaaatgtaaaagctcgttccttctacaatgagaagactccaaggattattgtatcc
cgctcccacgcaggaaaagtggagcaggttgcacggcagacttttggaaataagactgtg
ataatccccgctggtggagcaggttacaaagtgctggctctccttgacgtggctgaaaag
aatcaagaagaagctgatgtgtatatccacgtcacctatattaagaagtgggacatatgt
gctggaaatgcagtgttgagagcattgggtggccacatgactactctgacgggtgaagaa
attagttacactggctcagatggcaatgagggaggacttatagccagtatcaacatggac
cataaagcactaattgaaaaacttccagatttggaaaaaacatcacacaaataa

DBGET integrated database retrieval system