KEGG   Meleagris gallopavo (turkey): 100551300Help
Entry
100551300         CDS       T01523                                 

Definition
inositol monophosphatase 3-like
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mgp00562]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mgp00920]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:mgp04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 277 aa AA seqDB search
MMLSQGQKAPQLAAGCSGAAQDPGKCRMKLAVPQDFMEPSWPPFSLWLINSEERVDTTDQ
ETVSWDRNIPEDIKEKIQPKEVPAESVTVWIDPLDATQEYTEDLRQYVTTMVCVAVNGKP
VIGVIHKPFSAYTAWAMVDGGSNVKARSFYNEKTPRIIVSRSHAGKVEQVARQTFGNKTV
IIPAGGAGYKVLALLDVAEKNQEEADVYIHVTYIKKWDICAGNAVLRALGGHMTTLTGEE
ISYTGSDGNEGGLIASINMDHKALIEKLPDLEKTSHK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgagccagggccagaaagcgcctcagctcgctgctggctgcagtggagcagca
caagaccctggcaagtgccgcatgaaactggctgtgcctcaagacttcatggagcccagc
tggcctccattttctctctggcttataaactctgaggaacgtgttgatacaactgatcag
gagacagtctcttgggatcgcaatattcctgaagatataaaagaaaaaatacagcctaaa
gaggttccagcagaaagtgttactgtctggattgatccattagacgctacacaagagtac
acagaggatcttcggcagtatgtcacaacaatggtttgtgtggctgtaaatgggaaacca
gtaataggagtgatacataagccattctcagcatatacagcctgggcaatggtggatggt
gggtcaaatgtaaaagctcgttccttctacaatgagaagactccaaggattattgtatcc
cgctcccacgcaggaaaagtggagcaggttgcacggcagacttttggaaataagactgtg
ataatccccgctggtggagcaggttacaaagtgctggctctccttgacgtggctgaaaag
aatcaagaagaagctgatgtgtatatccacgtcacctatattaagaagtgggacatatgt
gctggaaatgcagtgttgagagcattgggtggccacatgactactctgacgggtgaagaa
attagttacactggctcagatggcaatgagggaggacttatagccagtatcaacatggac
cataaagcactaattgaaaaacttccagatttggaaaaaacatcacacaaataa

DBGET integrated database retrieval system