KEGG   Meleagris gallopavo (turkey): 100551337Help
Entry
100551337         CDS       T01523                                 

Definition
dual specificity mitogen-activated protein kinase kinase 2-like
Orthology
K04369  
mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Vascular smooth muscle contraction
VEGF signaling pathway
Gap junction
Toll-like receptor signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Melanogenesis
Influenza A
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mgp04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:mgp04012]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:mgp04370]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:mgp04068]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:mgp04810]
Cellular Processes; Cell communication; Gap junction [PATH:mgp04540]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:mgp04620]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:mgp04910]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:mgp04912]
Organismal Systems; Endocrine system; Melanogenesis [PATH:mgp04916]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:mgp04270]
Human Diseases; Infectious diseases; Influenza A [PATH:mgp05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
30
AA seq 424 aa AA seqDB search
MEERRLLPLASPKKGPQCYSNPKIWTPKKTIIGQLTSKIKEVTKKTDQTAKLANLVDLQK
KLEELELDEQQKKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKVQHKPSGLIMA
RKVRSLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLD
QVLKEAKRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVS
GQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVELSIGRYPIPPPDSKELE
AIFGRPMVDGAEGESHSVSPRARPPGRPISGHGMDNRPAMAIFELLDYIVNEPPPKLPNG
VFTQDFQEFVNKCLIKNPAERADLKMLMNHTFIKRSEVEEVDFAGWLCKTLRLNQPSTPT
RAAV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaaggaggctgctgccactggccagccccaaaaaggggccccagtgctactcc
aatcccaaaatctggactccaaaaaaaacaataatcggccaactgaccagcaaaatcaag
gaagtgaccaaaaaaacagatcaaacagccaagctggctaatctggtggaccttcagaag
aagctcgaggagctggagctggatgagcagcaaaagaagcgtttggaagctttcctcact
cagaaagccaaagtgggagagctgaaggatgatgactttgagcggatctctgagctgggg
gctggcaatggtggtgtggtcaccaaagtgcaacacaaaccctcagggctcattatggca
cggaaggtaaggagcttgattcatctagaaatcaaaccagccatcaggaatcagatcatc
cgagagctgcaggtgctgcatgagtgtaattccccatatattgtgggtttctatggagcc
ttctacagcgatggagagatttccatctgcatggagcacatggatggtggctccctggat
caagtgttgaaagaagccaaaagaattcctgaagaaatactggggaaagtcagtatagcg
gttctgagaggtttggcctatctgagagagaagcaccaaatcatgcacagagatgtgaag
ccttccaacatcctggttaactctcgaggagagattaagctgtgtgattttggggtcagt
ggtcagctcattgactccatggcaaactcttttgtgggaactcggtcctacatgtctcct
gagcggttgcagggcactcattactcagtccagtccgacatctggagcatgggtctgtca
ctggtggagctttctattggaaggtatccaatacccccaccagactccaaggaactggaa
gcaatatttggccgtcctatggtggatggggcagagggagaatctcacagcgtctcgccg
cgggccagacccccaggacgccccatcagtggccatggaatggacaaccgacctgcaatg
gccatttttgaactgctggactatatagttaatgagccacctcccaagttgccaaatgga
gtttttacgcaagatttccaggagtttgtaaataaatgcttaattaagaatccagcggaa
cgggcagatttgaagatgctgatgaatcacaccttcatcaagcgttctgaagtggaggag
gtggatttcgccggctggctctgcaaaacattgaggttaaaccagcccagcacacccacc
cgtgctgccgtgtga

DBGET integrated database retrieval system