KEGG   Meleagris gallopavo (turkey): 100551337Help
Entry
100551337         CDS       T01523                                 

Definition
dual specificity mitogen-activated protein kinase kinase 2-like
Orthology
K04369  
mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Vascular smooth muscle contraction
VEGF signaling pathway
Gap junction
Toll-like receptor signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Melanogenesis
Influenza A
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100551337
   04012 ErbB signaling pathway
    100551337
   04370 VEGF signaling pathway
    100551337
   04068 FoxO signaling pathway
    100551337
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100551337
  Cellular commiunity
   04540 Gap junction
    100551337
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100551337
  Endocrine system
   04910 Insulin signaling pathway
    100551337
   04912 GnRH signaling pathway
    100551337
   04916 Melanogenesis
    100551337
  Circulatory system
   04270 Vascular smooth muscle contraction
    100551337
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100551337
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100551337
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100551337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
30
AA seq 424 aa AA seqDB search
MEERRLLPLASPKKGPQCYSNPKIWTPKKTIIGQLTSKIKEVTKKTDQTAKLANLVDLQK
KLEELELDEQQKKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKVQHKPSGLIMA
RKVRSLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLD
QVLKEAKRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVS
GQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVELSIGRYPIPPPDSKELE
AIFGRPMVDGAEGESHSVSPRARPPGRPISGHGMDNRPAMAIFELLDYIVNEPPPKLPNG
VFTQDFQEFVNKCLIKNPAERADLKMLMNHTFIKRSEVEEVDFAGWLCKTLRLNQPSTPT
RAAV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaaggaggctgctgccactggccagccccaaaaaggggccccagtgctactcc
aatcccaaaatctggactccaaaaaaaacaataatcggccaactgaccagcaaaatcaag
gaagtgaccaaaaaaacagatcaaacagccaagctggctaatctggtggaccttcagaag
aagctcgaggagctggagctggatgagcagcaaaagaagcgtttggaagctttcctcact
cagaaagccaaagtgggagagctgaaggatgatgactttgagcggatctctgagctgggg
gctggcaatggtggtgtggtcaccaaagtgcaacacaaaccctcagggctcattatggca
cggaaggtaaggagcttgattcatctagaaatcaaaccagccatcaggaatcagatcatc
cgagagctgcaggtgctgcatgagtgtaattccccatatattgtgggtttctatggagcc
ttctacagcgatggagagatttccatctgcatggagcacatggatggtggctccctggat
caagtgttgaaagaagccaaaagaattcctgaagaaatactggggaaagtcagtatagcg
gttctgagaggtttggcctatctgagagagaagcaccaaatcatgcacagagatgtgaag
ccttccaacatcctggttaactctcgaggagagattaagctgtgtgattttggggtcagt
ggtcagctcattgactccatggcaaactcttttgtgggaactcggtcctacatgtctcct
gagcggttgcagggcactcattactcagtccagtccgacatctggagcatgggtctgtca
ctggtggagctttctattggaaggtatccaatacccccaccagactccaaggaactggaa
gcaatatttggccgtcctatggtggatggggcagagggagaatctcacagcgtctcgccg
cgggccagacccccaggacgccccatcagtggccatggaatggacaaccgacctgcaatg
gccatttttgaactgctggactatatagttaatgagccacctcccaagttgccaaatgga
gtttttacgcaagatttccaggagtttgtaaataaatgcttaattaagaatccagcggaa
cgggcagatttgaagatgctgatgaatcacaccttcatcaagcgttctgaagtggaggag
gtggatttcgccggctggctctgcaaaacattgaggttaaaccagcccagcacacccacc
cgtgctgccgtgtga

DBGET integrated database retrieval system