KEGG   Meleagris gallopavo (turkey): 100551391Help
Entry
100551391         CDS       T01523                                 

Definition
alpha-1A adrenergic receptor-like
Orthology
K04135  
adrenergic receptor alpha-1A
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:mgp04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:mgp04080]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:mgp04261]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:mgp04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
24
AA seq 461 aa AA seqDB search
MVFLSGNSSDCSNCTHSAGPVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLQSV
THYYIINLAVADLLLTSTVLPFSATMEILGYWAFGRIFCNIWAAVDVLCCTASIMSLCII
SIDRYIGVSYPLRYPSIVTEKRGLLALLCVWALSLVISIGPLFGWKEPAPEDETICQITE
EPGYVLFSALGSFYLPLTIILVMYCRVYVVAKRENKGLRSGLKMEKSRSEAVTLRIHRKN
APETAKTKHHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFVVMPLGSFFPTIKPPDT
LFKITFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRAQCLPRKHAAKKQSPSFNLNHPNS
QSMGGGKGVVRIPVGSGETFYKISKSEGVCEWKIFSAVQSAPTKNAIPKDKSSCTAAKVK
SKGFLQECCCAGTSGNAVHENCKVPTVKIHTMTLSENGEDV
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggttttcctctctgggaactcatccgactgttccaactgcacccactctgcagggccc
gtgaacatttccaaagccattttgctgggtgttattctaggggggctgatcatttttgga
gttttgggtaacattctggttatcctctctgtagcctgccacaggcatcttcagagtgtc
acccactactatataattaatctggctgtagccgacctcctcttgacatccactgtcctc
cccttctctgctactatggagattttgggctactgggcctttggaaggatcttctgcaac
atctgggcagctgtcgatgtgctttgctgcactgcttccattatgagcctctgcatcatc
tcgatagacagatacatcggggtgagctacccactgcgataccccagcatagtgacagag
aagagaggcctcctggctctgctgtgcgtgtgggcgctgtctctggtcatctccattgga
cctctttttggatggaaggaaccagcacccgaagacgagaccatctgccagatcaccgaa
gagcccggctacgtgctgttctccgcgctgggctccttctacctccccctgaccatcatc
ctggtgatgtactgccgagtgtatgtcgtggccaaaagggaaaacaaaggtttgaggtca
gggctgaagatggagaaatctcgttccgaagcagtgaccctacggatccaccgcaaaaac
gctcccgaaacngcaaaaaccaagcatcacttctcagtgcgtctcctcaagttctccaga
gaaaagaaagcagccaagaccctgggaattgtagtgggatgctttgttctgtgctggctt
ccattttttgtagtcatgcctcttggttctttctttcctacaatcaaacccccggacaca
ctttttaaaataacattttggcttggatatttaaacagctgcatcaaccccatcatctat
ccatgctccagtcaagagtttaagaaagcgttccaaaatgtcctgagagcgcagtgcctc
ccaagaaagcacgcagcaaagaagcaatccccaagcttcaacctcaatcatcccaacagc
caaagcatgggaggtggtaaaggtgtggtccgtatccccgtcggctcaggagaaaccttc
tataagatttccaaatccgagggggtctgtgaatggaagatattctccgccgtgcaaagc
gcgccgacaaaaaatgcgattcctaaagacaagtccagctgtactgctgccaaagtgaaa
agcaaaggtttcctccaggagtgctgctgtgcgggcacttcagggaacgcggtccatgaa
aactgcaaagtgccaaccgttaaaatacacaccatgaccctcagtgagaacggggaggat
gtctaa

DBGET integrated database retrieval system