KEGG   Meleagris gallopavo (turkey): 100551391Help
Entry
100551391         CDS       T01523                                 

Definition
alpha-1A adrenergic receptor-like
Orthology
K04135  
adrenergic receptor alpha-1A
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100551391
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100551391
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100551391
   04270 Vascular smooth muscle contraction
    100551391
G protein-coupled receptors [BR:mgp04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    100551391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
24
AA seq 461 aa AA seqDB search
MVFLSGNSSDCSNCTHSAGPVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLQSV
THYYIINLAVADLLLTSTVLPFSATMEILGYWAFGRIFCNIWAAVDVLCCTASIMSLCII
SIDRYIGVSYPLRYPSIVTEKRGLLALLCVWALSLVISIGPLFGWKEPAPEDETICQITE
EPGYVLFSALGSFYLPLTIILVMYCRVYVVAKRENKGLRSGLKMEKSRSEAVTLRIHRKN
APETAKTKHHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFVVMPLGSFFPTIKPPDT
LFKITFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRAQCLPRKHAAKKQSPSFNLNHPNS
QSMGGGKGVVRIPVGSGETFYKISKSEGVCEWKIFSAVQSAPTKNAIPKDKSSCTAAKVK
SKGFLQECCCAGTSGNAVHENCKVPTVKIHTMTLSENGEDV
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggttttcctctctgggaactcatccgactgttccaactgcacccactctgcagggccc
gtgaacatttccaaagccattttgctgggtgttattctaggggggctgatcatttttgga
gttttgggtaacattctggttatcctctctgtagcctgccacaggcatcttcagagtgtc
acccactactatataattaatctggctgtagccgacctcctcttgacatccactgtcctc
cccttctctgctactatggagattttgggctactgggcctttggaaggatcttctgcaac
atctgggcagctgtcgatgtgctttgctgcactgcttccattatgagcctctgcatcatc
tcgatagacagatacatcggggtgagctacccactgcgataccccagcatagtgacagag
aagagaggcctcctggctctgctgtgcgtgtgggcgctgtctctggtcatctccattgga
cctctttttggatggaaggaaccagcacccgaagacgagaccatctgccagatcaccgaa
gagcccggctacgtgctgttctccgcgctgggctccttctacctccccctgaccatcatc
ctggtgatgtactgccgagtgtatgtcgtggccaaaagggaaaacaaaggtttgaggtca
gggctgaagatggagaaatctcgttccgaagcagtgaccctacggatccaccgcaaaaac
gctcccgaaacngcaaaaaccaagcatcacttctcagtgcgtctcctcaagttctccaga
gaaaagaaagcagccaagaccctgggaattgtagtgggatgctttgttctgtgctggctt
ccattttttgtagtcatgcctcttggttctttctttcctacaatcaaacccccggacaca
ctttttaaaataacattttggcttggatatttaaacagctgcatcaaccccatcatctat
ccatgctccagtcaagagtttaagaaagcgttccaaaatgtcctgagagcgcagtgcctc
ccaagaaagcacgcagcaaagaagcaatccccaagcttcaacctcaatcatcccaacagc
caaagcatgggaggtggtaaaggtgtggtccgtatccccgtcggctcaggagaaaccttc
tataagatttccaaatccgagggggtctgtgaatggaagatattctccgccgtgcaaagc
gcgccgacaaaaaatgcgattcctaaagacaagtccagctgtactgctgccaaagtgaaa
agcaaaggtttcctccaggagtgctgctgtgcgggcacttcagggaacgcggtccatgaa
aactgcaaagtgccaaccgttaaaatacacaccatgaccctcagtgagaacggggaggat
gtctaa

DBGET integrated database retrieval system