KEGG   Meleagris gallopavo (turkey): 100551417Help
Entry
100551417         CDS       T01523                                 

Definition
pyruvate dehydrogenase [lipoamide] kinase isozyme 1-like
Orthology
K12077  
pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
mgp  Meleagris gallopavo (turkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 443 aa AA seqDB search
MQRARKLLAHKHGARWGKGLRSLDRQHEAGDPLQRPCPVQALLSAGPNRSSPHCPVQGAS
SAPSPPLSMKQLLTARSENACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLV
QSWYVQSLQEILDFKDKSSEDLGAIHSFTDTVIKIRNRHNDVIPTMAQGVIEYKESFGID
PVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKINPAHPKHIGSIDPSCNVVGVIRDG
YESAKSLCDLYYMSSPELVLEELNIKSPGQPMQVVYVPSHLYHMVFELFKVCXITITQFF
YTICLFSKIVFVXLSEPILDSRMSDRGGGVPMRKIDRLFNYMYSTAPRPRVETSRATPLA
GFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTESVERLPVYNKAAWKHYKA
NHEADDWCVPSSEPKDMTTFRST
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagggcccgaaagctgctggcccacaaacacggggcacgttggggaaaggggctc
aggagcctggaccggcagcacgaggccggagatcccctgcagagaccctgcccagtccaa
gccctgctcagcgcgggtccaaaccggagcagccctcactgccctgtgcagggagcctcc
agtgccccatctcctcctctcagcatgaagcagctgcttactgccagatctgaaaatgcc
tgtgaaaagacttcatttatgtttctgcgacaagagctgcctgtaagattagcaaacata
atgaaggaaataagcctgcttccagacaatcttctcagaacaccttcagttcagctggtg
cagagttggtatgtccaaagtcttcaggagatccttgactttaaagacaaaagttcagaa
gatttgggggctattcacagttttacagataccgtgataaaaatacgcaatcggcacaat
gatgtaattcctactatggctcaaggagtaatagaatacaaggaaagctttggcattgat
ccagtgacctcacagaatgtgcagtattttttagaccgtttctacatgagtcgcatttca
attagaatgctccttaatcaacactctttactgtttggtggaaaaattaatccagctcat
ccaaaacacattggaagcattgatcctagctgcaatgttgttggagttattagagacggc
tatgaaagtgccaagagtctttgtgatttatattacatgagctctccagaacttgtcctt
gaagagttgaatattaaatcaccaggacagcccatgcaagtggtgtatgtaccatcccac
ctctatcacatggttttcgaacttttcaaggtctgttgaattaccattacacaattcttt
tacacaatttgtttgtttagtaagattgtatttgtttgactttctgaaccaattctagat
agcagaatgagtgatcgtggtggaggtgttcctatgaggaaaattgacagactattcaac
tatatgtattcaacagcaccgcgtccacgtgttgagacatctcgagccacacctttggct
ggatttggttatggcttgcccatatcacgcctgtatgcacaatacttccaaggagacctg
aaactgtattctttagaaggttatggcacagatgcagttatttacataaaggccttatca
acagaatcagtcgaaagactccctgtgtacaataaagcagcctggaaacattataaagca
aaccatgaagcagatgactggtgtgtgccaagcagtgagccaaaggacatgactactttt
cgcagtacatag

DBGET integrated database retrieval system