KEGG   Meleagris gallopavo (turkey): 100551436Help
Entry
100551436         CDS       T01523                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-3-like
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mgp00562]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:mgp04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:mgp04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
29
AA seq 799 aa AA seqDB search
MPKPGPCEEARSGREAAPKLPASGSRSVRPLGGTAGGAGFRLARPLAVAVLACCYNGRLP
FLQQRFQGAWLPLQRFLPRERLEAERGVPAPPGDGALQRALKGCAAAKCERRRWGRTLRG
DVPLRNTCCAEGYLCCPARQGSLLPESDAQLSGRSRGPVRRCGAPGLSEDEDLQLMLQGS
LLLKVTSRRAKERRYRLQEDGITVVSERRFGRMASKHSFSVAHIVSVHRGHHSEGLRRYG
CAIPEWNCFTITFEGGRRNLDLGARDEDVALRWVRGLRTLRXRLRGMSQRERLEHWIHGM
LQRADKDKDNRMCFQEVQIMLRMANIHMDNAYAHQLFKECDHSGDGRLEDQELEDFCRRL
LRRPELEELFGHYSGEDCVLSAEELRDFLQDQGEEGTLHQACAIICAHELNEKARQQGLM
TLDGFTMYLLSAAGDILNQEHTEVHQDMSQPLCHYFISSSHNTYLTRNQIGGTSSTEAYV
RALMMGCRCVELDCWEGPDGEPIVCHGHTFTSKILFRDVIEAIRDCAFKRSPYPVILSLE
NHCGVEQQATMARHMKAILGDMLLTQPLEGQDPGVLPSPEQLKGKVLVKGKKLPELQCET
CSVTSIPDEEEEEETEEEDRLQVAKDASHVAPELSAMVVYCQATPFPGLAQALQQPRPYE
MSSFSERKARKLIKEAGPTFVHYTSRQLSRVYPLGLKMTSSNYNPXXXXPHSSHSSQPAP
SFNPRWEETLTFQLRVPELALVRFVVEDHDSTSCNDFVGQFTLPLGSMREGYRHIHLLSK
DGASLAPATLFVHVTCKRP
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagccgggcccttgtgaggaggcacgtagcggccgtgaagccgccccaaagctg
ccggcctccgggagccgctccgtccgtcccctcggcggcactgcggggggagccgggttt
cgcttagcgcggccgttggctgtcgcggtgttggcatgctgttacaatggacggcttccc
tttttgcagcagcgttttcagggagcttggctgccgctgcaacgcttcctgcctagagag
cggctggaagcagagcggggtgtcccggctccccctggggacggggcgcttcagcgggca
ctgaaaggctgcgctgccgctaagtgcgagcgcaggaggtggggtcggaccctgcggggc
gacgtaccgctccggaacacctgctgtgccgaaggctacctgtgctgcccagctcgccag
ggctccctgctgccggagtcggacgcgcagctgtccgggaggagccgaggccccgtgcgg
cgctgcggggctccaggtctgtcagaggatgaggacctccagctgatgctgcagggctcc
ctgctgctcaaggtgacctcacggcgggcgaaggagcggcggtaccgcctgcaggaggat
gggatcactgtggtgtctgagcggcgcttcgggcgcatggcctccaaacacagcttctcc
gttgcacacattgtgtcggtgcaccgggggcaccactcggaggggctgcgccggtacggc
tgtgccatccctgagtggaactgcttcaccatcaccttcgagggcgggcgcaggaacctg
gacctgggggcacgggatgaggacgtggcactgcgctgggtgcgggggctccgcacgctg
cggnggaggctgcggggcatgagccagcgggagaggctcgagcactggatccatggcatg
ctgcagcgtgccgataaggataaggacaacaggatgtgcttccaggaggtgcagatcatg
ctgcgcatggccaacatccacatggacaatgcctacgcccaccagctcttcaaggaatgt
gaccactctggtgatgggcggttggaggaccaggagctggaggacttctgccggcggctg
ctgcggcgcccggagctggaggagctctttgggcactattctggtgaggactgcgtgttg
tcagccgaggagctgcgggatttcctgcaggaccagggcgaggagggcaccctacaccag
gcctgtgccatcatctgtgcccatgagctcaacgagaaggcccggcagcagggcctgatg
acactggatggcttcacgatgtacctcctgtcagctgctggtgacatcctcaaccaggag
catactgaggtacaccaggacatgagccagcccttgtgccactacttcatctcctcctcc
cataacacctacctgacccgcaatcagattggaggcaccagcagcactgaagcctatgtc
agggcactgatgatgggatgccgttgtgtggagctggactgctgggagggtcccgatggg
gaacccatcgtctgccacggccatacattcacctccaaaatcctcttccgtgatgtcatc
gaggctatccgcgattgcgccttcaagcgatcgccgtaccccgtcatcctctcgctggag
aaccactgcggggtagagcagcaggccaccatggcgcggcacatgaaggccatccttggg
gacatgctgctgacacagcccctggaaggacaagaccccggtgtcctcccatccccagag
cagctgaaggggaaagtcctggtgaagggcaagaagctgccagagctgcagtgtgagacc
tgcagcgtcacctccatcccggatgaagaggaggaagaggagacagaggaagaggacagg
ctgcaggttgccaaagatgcttcacatgtggccccagagctgtcagccatggtggtgtac
tgccaggccacccccttccctggcctggcccaggccctacagcagccccggccctatgag
atgtcctccttcagtgagagaaaggctcggaaactcatcaaggaggcaggccccacgttt
gtgcactacacctcccggcagctgagccgtgtctaccctttgggattgaagatgacctcc
tccaactacaaccccnnnnnnnnnnnnccccattcctcccattcatctcagcctgctccc
agcttcaacccacgctgggaggagacgctcacgttccagctgcgggtccctgagctggcg
ttggtgcgcttcgtggtggaggaccacgacagcacctcctgcaatgactttgtggggcag
ttcacactgccgctgggcagcatgcgagaagggtaccgccacatccacctgctctccaag
gatggcgcgtccctggcccctgccacgctctttgtgcacgtcacatgcaaacgcccatga

DBGET integrated database retrieval system