KEGG   Meleagris gallopavo (turkey): 100551436Help
Entry
100551436         CDS       T01523                                 

Gene name
PLCD3
Definition
(RefSeq) phospholipase C, delta 3
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100551436 (PLCD3)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100551436 (PLCD3)
   04070 Phosphatidylinositol signaling system
    100551436 (PLCD3)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100551436 (PLCD3)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100551436 (PLCD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
29
AA seq 818 aa AA seqDB search
MGEGGWLHGRACKHTYTHVCARTHVHMAAHTHTYVHAILLPPPSDPKSLLQTQPPGSLPV
PPRSSPHGPGSAGRLICGRRARPRPEQSGGVLKKLGLSEDEDLQLMLQGSLLLKVTSRRA
KERRYRLQEDGITVVSERRFGRMASKHSFSVAHIVSVHRGHHSEGLRRYGCAIPEWNCFT
ITFEGGRRNLDLGARDEDVALRWVRGLRTLRGRLRGMSQRERLEHWIHGMLQRADKDKDN
RMCFQEVQIMLRMANIHMDNAYAHQLFKECDHSGDGRLEDQELEDFCRRLLRRPELEELF
GHYSGEDCVLSAEELRDFLQDQGEEGTLHQACAIICAHELNEKARQQGLMTLDGFTMYLL
SAAGDILNQEHTEVHQDMSQPLCHYFISSSHNTYLTRNQIGGTSSTEAYVRALMMGCRCV
ELDCWEGPDGEPIVCHGHTFTSKILFRDVIEAIRDCAFKRSPYPVILSLENHCGVEQQAT
MARHMKAILGDMLLTQPLEGQDPGVLPSPEQLKGKVLVKGKKLPELQCETCSVTSIPDEE
EEEETEEEDRLQAKDASHVAPELSAMVVYCQATPFPGLAQALQQPRPYEMSSFSERKARK
LIKEAGPTFVHYTSRQLSRVYPLGLKMTSSNYNPQEMWNAGCQLVALNFQTPGYEMDLNT
GRFLGNGGCGYVLKPQFLRSPHSGSPHPLVLRIRVITAQQLPKLNREKLSSIVDPFVRVE
IYGVTADCSKQQTAYRSNNGFNPRWEETLTFQLRVPELALVRFVVEDHDSTSCNDFVGQF
TLPLGSMREGYRHIHLLSKDGASLAPATLFVHVTCKRP
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atgggggagggggggtggctgcacgggcgtgcgtgcaaacacacgtacacacatgtatgt
gcacgcacacacgtgcatatggccgcacacacacacacgtatgtgcatgcaatcctcctc
ccccccccctccgatccaaaatctctactgcaaacccaacccccgggctccctcccggta
ccgccccgctcctccccgcacggccccgggagcgccggacgactgatctgcgggcggagg
gcgcgaccccgccccgagcagagcgggggggtcttgaagaagttgggtctgtcagaggat
gaggacctccagctgatgctgcagggctccctgctgctcaaggtgacctcacggcgggcg
aaggagcggcggtaccgcctgcaggaggatgggatcactgtggtgtctgagcggcgcttc
gggcgcatggcctccaaacacagcttctccgttgcacacattgtgtcggtgcaccggggg
caccactcggaggggctgcgccggtacggctgtgccatccctgagtggaactgcttcacc
atcaccttcgagggcgggcgcaggaacctggacctgggggcacgggatgaggacgtggca
ctgcgctgggtgcgggggctccgcacgctgcgggggaggctgcggggcatgagccagcgg
gagaggctcgagcactggatccatggcatgctgcagcgtgccgataaggataaggacaac
aggatgtgcttccaggaggtgcagatcatgctgcgcatggccaacatccacatggacaat
gcctacgcccaccagctcttcaaggaatgtgaccactctggtgatgggcggttggaggac
caggagctggaggacttctgccggcggctgctgcggcgcccggagctggaggagctcttt
gggcactattctggtgaggactgcgtgttgtcagccgaggagctgcgggatttcctgcag
gaccagggcgaggagggcaccctacaccaggcctgtgccatcatctgtgcccatgagctc
aacgagaaggcccggcagcagggcctgatgacactggatggcttcacgatgtacctcctg
tcagctgctggtgacatcctcaaccaggagcatactgaggtacaccaggacatgagccag
cccttgtgccactacttcatctcctcctcccataacacctacctgacccgcaaccagatt
ggaggcaccagcagcactgaagcctatgtcagggcactgatgatgggatgccgttgtgtg
gagctggactgctgggagggtcccgatggggaacccatcgtctgccacggccatacattc
acctccaaaatcctcttccgtgatgtcatcgaggctatccgcgattgcgccttcaagcga
tcgccgtaccccgtcatcctctcgctggagaaccactgcggggtagagcagcaggccacc
atggcgcggcacatgaaggccatccttggggacatgctgctgacacagcccctggaagga
caagaccccggtgtcctcccatccccagagcagctgaaggggaaagtcctggtgaagggc
aagaagctgccagagctgcagtgtgagacctgcagcgtcacctccatcccggatgaagag
gaggaagaggagacagaggaagaggacaggctgcaggccaaagatgcttcacatgtggcc
ccagagctgtcagccatggtggtgtactgccaggccacccccttccctggcctggcccag
gccctgcagcagccccggccctatgagatgtcctccttcagtgagagaaaggctcggaaa
ctcatcaaggaggcaggccccacgtttgtgcactacacctcccggcagctgagccgtgtc
taccctttgggattgaagatgacctcctccaactacaacccccaggagatgtggaacgcc
ggctgccagctggtggccctcaacttccagacgccaggctatgagatggacctgaacacc
gggcgcttcctgggcaatgggggctgtggttatgtgctgaaaccccaattcctgcgcagc
ccccacagcggcagcccccacccgctagtgttgcgcatcagggtcatcacggcacagcag
ctgccaaagctgaaccgggagaagctcagctccatcgtggacccatttgttagagtggag
atctatggggtgacggcggactgcagcaagcagcaaactgcctacaggagcaacaatggc
ttcaacccacgctgggaggagacgctcacgttccagctgcgggtccctgagctggcgttg
gtgcgcttcgtggtggaggaccacgacagcacctcctgcaatgactttgtggggcagttc
acactgccgctgggcagcatgcgagaagggtaccgccacatccacctgctctccaaggat
ggcgcgtccctggcccctgccacgctctttgtgcacgtcacatgcaaacgcccatga

DBGET integrated database retrieval system