KEGG   Meleagris gallopavo (turkey): 100551443Help
Entry
100551443         CDS       T01523                                 

Gene name
NUP205
Definition
nuclear pore complex protein Nup205-like
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100551443 (NUP205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 1562 aa AA seqDB search
VKQLRNRADEDARMIHMSIQMGNDPPISLRRDLEHLMLLVVLSKFVRQMGDLLPSTIYIP
YLKMLRGLASGPQCAHYCFSLLKVNGSSHAENIQGAGGSPVSWEHFFHSLMLYHEHLRKD
LPSADSVQYRHLPLRGITQKEQDGLIAFLQLTTVIVNWSENARLALCEHPQWTPVVVILG
LLQCSIPPVLKAELLETLTAFGKSPEIAASLWQSLEYTQILQTVRTPGQRQAIGIEVELN
EIESRCEEYPLTRAFCRLISTLVESSFPSNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAY
RRAAEKWEVAEVVLEVFYKLLRDYEPQLEDFVDQYVELQGDEIIAYKPPGFNLMYHLLNE
SPMLELSLSLLEEGVKQLDTYAPFPGKKHLEKAVEYCLALLNLTLQKENLFMDLLRESHL
SLIVTPLEQLLQGINPRTKKADHVVNIARYLYHGNSNPELAFESAKILCCISCNSNIQIK
LVGDFTHDQSTSQKLMAGFVECLDNEDAEELINPDEELEPEKKRARIHHETRIHILNLLI
TSLECSPPSLALYLLGYELKKPVSTTNLQDPGVLGCPRTCLHAILNILEKGTDSRNGPTA
VQESPHLAELCYQVIYQLCACSDTSGPTMRYLRTSQDFLFTQLQYLPFSIREHEISTLNQ
MSWLMKTAAIEMRVTSLNRQRSHTQRLLHLLLDDMPVKPYLADGEGGMEDESRSVSGFLH
FDTASKVRRKILSILDSIDFSQDIPEPLQLDFFDRVQIEQVIANCEHKNARGQVVCNVKH
LHRVLVAEVNALQGMAAIGQRPLLMEEINTILQYVVERNKLLQCLHAKKHALESWRQLVE
IILTACPQDLIQAEDRQLIIRDLLQDVHDKILDDDAAQELMPVVAGAVFTLTAHLSQSVK
TEQKQPLAVPMTGQSQYVLMLDGSFTSSPGSESISMGFASIGDSSLHIILKKLLDFILKT
GGGFQRVRTHLYGSLLYYLQIAQRPDEPDTLEAAKKTMWERLTAPEDVFSKLQRENMAII
ESYGAALMEVVCRDACDGHEIGRMLALALLDRIVSVDKQQQWLLYLSNSGYLKVLVDSLV
DDDLTLQSLLMPQPPLLKALYTYESKMAFLTRVAKSQQGALELLRSGVIVRLAQCQVYDM
RPETDHQGMYGMRDPPLFIPAPVERYRQILLPALQLCQVILTSSMAQHLQAAGQVLQFLI
SHSDTIQAILRCQHVSVGSLQELASLTGIISKAALPGVLNELDVDVNEGTQMELQGHIGR
FQRQCLGLLSRFGGSDRLRQFKLQDDNTEGDRVNKRDEIELAMQQICANVMEYCESLMLQ
SAPTFEHTVCLFTPSLSESTNRDGPRQDTQAPVVPYWRLPGLGIIIYLLKQSTNDFFSYY
DSHRQSVNKLQNVEQLPPDEIKELCQSVMPAGVDKISTAQKYVLARRRLVKLINNRAKLL
SLCSYIIETCLFILWRHLEHYLLNYTPTDSQDSLLSSRISFKRGRLQDSFGSESSLDFSS
GLNRVSQHDIDQLQIETTNSFGESLQKKLLDIEGLYSKVRSRYTFIQALVRRIRGLLRIS
RT
NT seq 4689 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcagctgagaaaccgtgctgatgaagatgctcgcatgatccacatgagtattcag
atgggaaatgatccacctatttctcttcggagagatctggagcatttaatgcttttagtt
gtcttgtcaaagtttgttaggcaaatgggagatcttcttccatccacaatttacatccca
tacttgaaaatgctacggggactggccagtgggcctcagtgtgctcattactgctttagt
ttgctgaaagtcaatggcagtagtcatgcggaaaacatccaaggagcaggtggcagccct
gtctcctgggagcattttttccactctttgatgctttatcatgaacacttaaggaaagac
ttgccaagtgcagacagcgttcagtatcggcacctgcctctccgaggaatcacacagaaa
gaacaggatgggttaattgcctttttacagctgaccactgttatagtaaattggagtgag
aatgctcgcttggctctttgtgaacaccctcagtggacaccagtggtggtcattctggga
cttctgcagtgcagcattcctcctgttttgaaagctgaattgttagaaactcttactgct
tttgggaaatctcccgaaatagctgcttcactttggcaatctctggaatacacccagata
ttacagacagtgagaactccaggccagagacaagcaattggtattgaggttgaactgaat
gagattgaatccagatgtgaggagtatcctttaacccgtgccttctgccgactcatcagc
acacttgtagagagttcattcccctcaaacttgggggcaggtctccgcccaccaggcttt
gatccctatctccagttcttgagggactctgtgtttcttcgattccgcaccagagcttac
cgaagagctgctgaaaaatgggaagtggctgaggtggtactagaggtattttacaaattg
ctgcgggactacgaacctcaacttgaagacttcgtggaccaatatgtggagttacaagga
gatgaaataatagcatacaaaccacctggattcaatttgatgtatcatctattgaatgag
tccccaatgctggaactgtctctgagtttgctggaggaaggggttaagcaactggatact
tatgccccatttcctgggaagaagcatttagagaaagcagtagagtattgccttgcactt
ctaaacttaaccctacagaaagagaatctttttatggatctgttacgggaaagccatctt
tctttaattgtcacaccactggagcagctgcttcagggaatcaatccccgcaccaaaaag
gccgatcatgtggtgaatattgctaggtatctttatcatggaaacagcaatcctgaactg
gcttttgaaagtgccaagattttgtgctgcatttcttgtaattccaacatccagataaaa
ctagttggtgatttcacacatgatcaaagtactagtcagaagctgatggccgggtttgtg
gaatgtttggacaatgaagatgcggaagaattaattaatccagatgaagagctggagcct
gaaaagaagcgggcgcgaatccatcatgaaacaaggattcatattctgaatctcctcatc
acgtctcttgagtgtagtcctcccagccttgctctgtatctcttgggatatgaactaaag
aaacctgtcagcaccacaaatctgcaagacccaggtgtcttgggttgtccacggacttgc
cttcatgctattttgaacatactggaaaaaggcactgattcaagaaatgggcctacagca
gttcaggaatctcctcatcttgcagaactctgttatcaggtgatctatcagttatgtgca
tgctctgacacatcaggtccaactatgcgatacctgaggaccagtcaggatttcttattc
actcagctgcagtatttgccattttctataagagaacatgagatttcaacactgaaccag
atgtcatggttaatgaaaactgcagctatagaaatgcgagtgacatcacttaaccgccag
cgctcccacacacagagactgctgcatctgctgcttgatgacatgcctgtgaaaccatac
ttggctgatggtgaaggaggaatggaagatgaaagtcgatcagtcagtggttttctccat
tttgacactgcctccaaagttcgcaggaaaatcttaagtatcttggattcaattgacttc
agtcaggacattccagagcctttgcaactggatttttttgatcgtgttcagattgagcaa
gtcattgctaattgtgaacacaagaatgcacgtgggcaagtggtctgcaatgtcaagcat
cttcacagagttctggttgcagaagtcaatgccctgcaaggaatggcagcaataggtcag
agaccattacttatggaggagatcaacaccatcctgcaatacgtggtggagcggaataaa
ctgttgcaatgcctccatgctaagaagcatgctttagagtcatggaggcagctggtggaa
attatactcactgcctgcccccaggatcttatacaggctgaagacagacaattgattatc
cgtgatttattacaggatgttcatgacaagatcctggatgatgatgcagctcaggagctg
atgccagtggtggcaggggctgtgttcaccctcactgcccatcttagccagtctgtgaaa
acagagcagaaacagccacttgcagtcccaatgactggacagtcccaatatgtcttgatg
ctggatggttcttttacctcatcacctggctctgagagcatatccatgggttttgcttcc
attggtgactcttcactccacatcatcttaaaaaagctgctggatttcattttgaaaaca
ggtggtggattccagagagtgaggacacacctttatgggtcactgctttattatttacag
attgcacagagaccggatgaaccagacactttagaagctgctaaaaaaacaatgtgggaa
cgtctgacagctcctgaagatgtgtttagtaaattgcaacgagaaaacatggcaattatt
gagagttatggggcagctctcatggaggtggtctgtcgtgatgcttgtgatggccatgag
ataggcaggatgttggcattggctttgcttgaccgcattgtttcagtagacaagcagcag
cagtggcttttatatctctccaatagtggctacctgaaggtgcttgtggatagcctagta
gatgatgatctcactcttcagagcttactcatgcctcagccacctttacttaaggcgttg
tacacctacgaatccaaaatggcattcctcaccagggtagctaagagtcagcaaggggca
ttggaactgttgcggtctggtgtgattgtgaggctggcacagtgtcaagtatatgacatg
cgacctgaaacagatcatcagggaatgtatggaatgagagatcccccactcttcattcct
gctccagtggaacgttatcgccagattcttcttccagctcttcagctgtgccaagtgatt
ctcacatccagcatggcacaacacctgcaagcagcgggacaggttttgcagtttctcatt
tcccattcagatactatccaggcaatcctgaggtgtcaacatgttagtgttggatctctc
caagaactggcctccctgacaggaataatcagcaaggcagctttgcctggggtgctaaat
gaattggatgtcgatgttaatgaagggacacagatggagctacaaggacatataggtcga
tttcagcgccagtgcttaggacttctaagtcgatttggtggttcagacaggctacggcag
tttaaactgcaggatgataacacagaaggagacagagtgaacaagagagatgaaattgag
ttggccatgcaacagatctgtgcaaatgtgatggagtactgtgagtcgctgatgttgcag
agtgcccccacttttgagcacactgtttgtctgttcactcctagcctgtcagagtcgacc
aaccgagatgggcctcgtcaagatacacaagcaccagtggtcccatactggcgcttgcct
ggtttgggcattatcatctatctactgaaacagagcactaatgatttcttcagttactat
gatagccatcgtcagagtgttaacaaactgcagaatgtggagcaactcccaccagatgaa
ataaaagagctgtgtcaatcagttatgccagctggagttgataaaatctctactgcccaa
aaatatgttttggcaaggcgacgtctggtgaagctaataaacaaccgagccaagctgctt
tctctttgttcttatattatagaaacatgtctcttcattctttggcgtcatctggaacac
tatctactgaattacacacctactgactcccaagactcattgctatcttccagaatatca
tttaagagaggaagactgcaagattcctttggttcagagtccagcttggatttcagcagt
ggactgaatcgagtgagtcagcatgatatagatcagcttcagattgaaaccaccaacagt
tttggtgaatccctacagaagaagcttctggacattgaggggttatattctaaggttcgg
tcacgttacacctttattcaagctcttgtgagacgtatccgtggtctcctaaggatatca
aggacctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system