KEGG   Meleagris gallopavo (turkey): 100551476Help
Entry
100551476         CDS       T01523                                 

Gene name
USP8
Definition
ubiquitin specific peptidase 8
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:mgp04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 1124 aa AA seqDB search
MPAVASVPKELYLCTSLKDLNKKTEIKPEKTSTKSYVQSALKIFKAAEESRLDRDEEKAY
ILYMKYVAVYNFIKKRPDFKQQQDYFHSILGPTNIKKAIEEAERLSDSLKLRYEEAEVRK
KLEERDRQELQNKQEPKDDGKSSAKSLSETTADCKGKSQRINGETKHSLERKDQAESFSG
AVTAEKLFAMMTDKSIELIIMDARSLKDYQESCIPRSVSVPEEAISPGVTASWIEARLPE
DSKDPWKRRGHFDYVVLLDWFSSAEDLKLGTTLRSLKDALFKWESKTILQNEPLVLEGGY
ENWLLCFPQYTTNAKVTPPQHGRSEAVTVSLDFTYPSLEEPAPVLPVAPIKPSPSEVVEN
EETGANLEERLKSLNRPSVEGAAVPKPDSSFIVNPASITRNIPEVDRSKKPSIKIPDDSK
PKSESTPSDSQPIENARVVPDRSTKPLLDAKSVLTEEEKSRVHAETAALMEKNKREKELR
ERQKEEQKERLKREKEEQEQKAKEEQREKEHKEKLQQSKEEREQKERDEQIKREQEEKEK
EKARKEAIEAKKQNKNELESIDAKKVETDKMSTERREKGTRTPDMQRRVLGDASPSKVTF
SQNLLQQTEVKGQPDSGAQKPGPLREDSEQDTERLKSQREPLIRARSEEMGRIIPGLPEG
WVKFLDPITGTFRYYHSPTNTVEMYPPEMAPSSTPPATPPTRKPKPQMAAEREREHSKLK
RSYSSPDITQAIQEEEKKRIPVTPAVNRENKPVYYPKTEISRLSASQIRNLNPVFGGSGP
ALTGLRNLGNTCYMNSILQCLCNAPHLAEYFNRNLYHDDINRSNFLGHKGEVAEEFGVIM
KALWTGQYKYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYK
EENNDHLDDLRAAELAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSL
PLASTSKCTLQECLRLFSKEEKLTDNNRFYCSHCKTRRDSLKKIEIWKLPPVLLVHLKRF
SYDGRWKQKLQTSVDFPLETLDLSQYVIGPKNNLKRYNLFSVSNHYGGLDGGHYTAYCKN
ASKQRWFKFDDHEVSEISASSVKSSAAYILFYTSYEQRAVDMAT
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctgtggcatctgtacctaaggagctgtatctttgtacttcattgaaagatctc
aacaagaagacggaaataaaacctgaaaagaccagtacaaagagttatgtgcagagcgcc
cttaagattttcaaagccgcagaagaaagcagattggaccgagatgaagaaaaagcttat
atcctgtatatgaaatatgtggctgtttataattttattaaaaagagacctgattttaag
cagcaacaggattatttccattccattcttgggcctacaaatataaaaaaagctattgaa
gaagctgaaagactctcagacagccttaaactcagatatgaggaagctgaagtacggaaa
aaacttgaagaaagggacagacaagagctgcagaacaagcaagaaccaaaagatgatgga
aagagttcagccaaaagcttatcagaaactacagcagattgcaaaggaaaaagccagagg
atcaatggtgagacgaagcactcactggaaagaaaggatcaagctgagagttttagtgga
gcagtcacagctgagaaactgtttgcaatgatgacagacaaaagcattgaattgattata
atggatgctcgaagcttgaaggactaccaggagtcctgtattccaagatctgtcagtgtt
ccagaagaagctatcagtcctggagttactgctagttggattgaagctagactcccagag
gattctaaagatccatggaagaggagaggacactttgattatgttgtactgctggactgg
tttagttctgcagaagacttaaagctaggaacaactcttcggagcctgaaagatgcactt
tttaagtgggaaagcaaaactatactgcagaatgaacctttggttctagaaggaggctat
gaaaactggctcctttgctttccccagtacacaacaaatgctaaagtaactccaccccag
catggcaggagtgaagcagtaactgtgtctttggattttacgtatccatctctggaagag
ccagctcctgttctacctgttgcccctataaagccttctccatcagaagtggtcgaaaat
gaagaaacaggagctaatttggaagagagattaaagtcactgaacagaccaagtgtagaa
ggtgctgctgttccaaaacctgacagctcattcatagttaatccagcatcaattacaaga
aatatccctgaggttgatcgttctaaaaagccttccataaaaatacctgatgatagtaaa
ccaaaatctgaaagtacacccagtgacagccaacctattgagaatgcccgcgtggttcca
gaccggtccacaaagccattacttgatgctaagagtgttctgacagaagaagaaaaaagc
cgtgtacatgcagaaactgctgctctgatggagaaaaacaaacgagaaaaagaactgcgg
gagaggcagaaggaagaacaaaaagagagactcaagcgagaaaaggaagaacaagagcaa
aaggcaaaggaagaacagagagaaaaggaacacaaagaaaagctacagcaatccaaagag
gagagggaacagaaggagagagacgagcagataaagagagaacaggaggagaaggaaaaa
gaaaaagcacgcaaagaagcaatagaagcaaaaaagcaaaataaaaatgaactagaaagc
attgatgcaaaaaaggttgagactgacaaaatgtctacagaaagaagagaaaagggcact
cgaacaccagatatgcagagacgtgtactgggtgatgcatctccaagcaaggtcaccttc
tctcaaaatcttttacagcaaactgaggttaaaggacaaccagacagtggagctcaaaag
ccaggaccccttagagaggattctgaacaagatactgaaagacttaaatctcagcgggag
ccattgatcagagcccgaagtgaagaaatggggaggataataccaggactgcctgaaggt
tgggtaaagtttctggatccaatcactggaacctttcgttactatcactcgccaacgaac
actgttgagatgtatccaccagaaatggctccctcgtccacacctccagccaccccacca
acccgcaaacccaagccacagatggctgcagagcgggagcgagaacactccaaactgaag
cgctcctactcatccccagatataacccaagccattcaggaggaagagaagaaaaggatt
cctgtaactcctgcagtcaatcgtgaaaataaaccagtctattaccctaaaacagaaatt
tcaagactctctgcatcacagattaggaaccttaatcctgtgtttgggggatcgggacca
gctcttacaggacttcgtaatctagggaacacttgctatatgaactccatactacagtgt
ctgtgcaacgcacctcacctagctgagtactttaacagaaacttgtatcatgatgatatt
aacaggtccaatttcctggggcataaaggtgaagtggctgaagagtttggagtaataatg
aaagctttgtggacaggacagtataaatatatcagtccaaaagacttcaaaattacaatt
gggaagattaatgatcagtttgcaggatatagccagcaagactcccaggagctgcttctc
ttcctaatggacggcttgcacgaagacctcaataaagctgacaacaggaagagatacaag
gaagaaaacaacgatcatcttgatgacctcagagcagcagaactagcctggcagaagcac
aaacagctcaacgaatccattattgtggcactcttccaaggccagttcaaatcaacagtg
cagtgtctcacatgtcacaagaagtcccggacctttgaggcgttcatgtatttgtcctta
ccacttgcatccaccagtaaatgcacactgcaggaatgccttagattgttctccaaagag
gaaaagctcaccgacaacaacagattttactgtagccattgcaaaactcgaagggattct
ttgaaaaaaatagaaatttggaaattaccacctgtgcttctcgtgcacctgaaacgattt
tcctatgatggaagatggaagcaaaagcttcagacctctgtagatttcccattggaaact
cttgatctttcacagtatgttatcggtccaaagaataatttgaagagatacaatctattt
tcagtatcaaatcattatggtgggttggacggagggcactacaccgcctactgcaaaaat
gcctcaaaacagcgctggtttaagtttgatgaccatgaagtatctgagatctcagcatca
tctgtgaaatcctcagctgcatatattctcttttacacttcttatgaacaacgagcagtg
gatatggccacataa

DBGET integrated database retrieval system