KEGG   Meleagris gallopavo (turkey): 100551476Help
Entry
100551476         CDS       T01523                                 

Gene name
USP8
Definition
ubiquitin specific peptidase 8
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100551476 (USP8)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100551476 (USP8)
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100551476 (USP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 1115 aa AA seqDB search
MPAVASVPKELYLCTSLKDLNKKTEIKPEKTSTKSYVQSALKIFKAAEESRLDRDEEKAY
ILYMKYVAVYNFIKKRPDFKQQQDYFHSILGPTNIKKAIEEAERLSDSLKLRYEEAEVRK
KLEERDRQELQNKQEPKDDGKSSAKSLSETTADCKGKSQRINGETKHSLERKDQAESFSG
AVTAEKLFAMMTDKSIELIIMDARSLKDYQESCIPRSVSVPEEAISPGVTASWIEARLPE
DSKDPWKRRGHFDYVVLLDWFSSAEDLKLGTTLRSLKDALFKWESKTILQNEPLVLEGGY
ENWLLCFPQYTTNAKVTPPQHGRSEAVTVSLDFTYPSLEEPAPVLPVAPIKPSPSEVVEN
EETGANLEERLKSLNRPSVEGAAVPKPDSSFIVNPASITRNIPEVDRSKKPSIKIPDDSK
PKSESTPSDSQPIENARVVPDRSTKPLLDAKSVLTEEEKSRVHAETAALMEKNKREKELR
ERQKEEQKERLKREKEEQEQKAKEEQREKEHKEKLQQSKEEREQKERDEQIKREQEEKEK
EKARKEAIEAKKQNKNELESIDAKKVETDKMSTERREKGTRTPDMQRRVLGDASPSKQTE
VKGQPDSGAQKPGPLREDSEQDTERLKSQREPLIRARSEEMGRIIPGLPEGWVKFLDPIT
GTFRYYHSPTNTVEMYPPEMAPSSTPPATPPTRKPKPQMAAEREREHSKLKRSYSSPDIT
QAIQEEEKKRIPVTPAVNRENKPVYYPKTEISRLSASQIRNLNPVFGGSGPALTGLRNLG
NTCYMNSILQCLCNAPHLAEYFNRNLYHDDINRSNFLGHKGEVAEEFGVIMKALWTGQYK
YISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDD
LRAAELAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCT
LQECLRLFSKEEKLTDNNRFYCSHCKTRRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQK
LQTSVDFPLETLDLSQYVIGPKNNLKRYNLFSVSNHYGGLDGGHYTAYCKNASKQRWFKF
DDHEVSEISASSVKSSAAYILFYTSYEQRAVDMAT
NT seq 3348 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctgtggcatctgtacctaaggagctgtatctttgtacttcattgaaagatctc
aacaagaagacggaaataaaacctgaaaagaccagtacaaagagttatgtgcagagcgcc
cttaagattttcaaagccgcagaagaaagcagattggaccgagatgaagaaaaagcttat
atcctgtatatgaaatatgtggctgtttataattttattaaaaagagacctgattttaag
cagcaacaggattatttccattccattcttgggcctacaaatataaaaaaagctattgaa
gaagctgaaagactctcagacagccttaaactcagatatgaggaagctgaagtacggaaa
aaacttgaagaaagggacagacaagagctgcagaacaagcaagaaccaaaagatgatgga
aagagttcagccaaaagcttatcagaaactacagcagattgcaaaggaaaaagccagagg
atcaatggtgagacgaagcactcactggaaagaaaggatcaagctgagagttttagtgga
gcagtcacagctgagaaactgtttgcaatgatgacagacaaaagcattgaattgattata
atggatgctcgaagcttgaaggactaccaggagtcctgtattccaagatctgtcagtgtt
ccagaagaagctatcagtcctggagttactgctagttggattgaagctagactcccagag
gattctaaagatccatggaagaggagaggacactttgattatgttgtactgctggactgg
tttagttctgcagaagacttaaagctaggaacaactcttcggagcctgaaagatgcactt
tttaagtgggaaagcaaaactatactgcagaatgaacctttggttctagaaggaggctat
gaaaactggctcctttgctttccccagtacacaacaaatgctaaagtaactccaccccag
catggcaggagtgaagcagtaactgtgtctttggattttacgtatccatctctggaagag
ccagctcctgttctacctgttgcccctataaagccttctccatcagaagtggtcgaaaat
gaagaaacaggagctaatttggaagagagattaaagtcactgaacagaccaagtgtagaa
ggtgctgctgttccaaaacctgacagctcattcatagttaatccagcatcaattacaaga
aatatccctgaggttgatcgttctaaaaagccttccataaaaatacctgatgatagtaaa
ccaaaatctgaaagtacacccagtgacagccaacctattgagaatgcccgcgtggttcca
gaccggtccacaaagccattacttgatgctaagagtgttctgacagaagaagaaaaaagc
cgtgtacatgcagaaactgctgctctgatggagaaaaacaaacgagaaaaagaactgcgg
gagaggcagaaggaagaacaaaaagagagactcaagcgagaaaaggaagaacaagagcaa
aaggcaaaggaagaacagagagaaaaggaacacaaagaaaagctacagcaatccaaagag
gagagggaacagaaggagagagacgagcagataaagagagaacaggaggagaaggaaaaa
gaaaaagcacgcaaagaagcaatagaagcaaaaaagcaaaataaaaatgaactagaaagc
attgatgcaaaaaaggttgagactgacaaaatgtctacagaaagaagagaaaagggcact
cgaacaccagatatgcagagacgtgtactgggtgatgcatctccaagcaagcaaactgag
gttaaaggacaaccagacagtggagctcaaaagccaggaccccttagagaggattctgaa
caagatactgaaagacttaaatctcagcgggagccattgatcagagcccgaagtgaagaa
atggggaggataataccaggactgcctgaaggttgggtaaagtttctggatccaatcact
ggaacctttcgttactatcactcgccaacgaacactgttgagatgtatccaccagaaatg
gctccctcgtccacacctccagccaccccaccaacccgcaaacccaagccacagatggct
gcagagcgggagcgagaacactccaaactgaagcgctcctactcatccccagatataacc
caagccattcaggaggaagagaagaaaaggattcctgtaactcctgcagtcaatcgtgaa
aataaaccagtctattaccctaaaacagaaatttcaagactctctgcatcacagattagg
aaccttaatcctgtgtttgggggatcgggaccagctcttacaggacttcgtaatctaggg
aacacttgctatatgaactccatactacagtgtctgtgcaacgcacctcacctagctgag
tactttaacagaaacttgtatcatgatgatattaacaggtccaatttcctggggcataaa
ggtgaagtggctgaagagtttggagtaataatgaaagctttgtggacaggacagtataaa
tatatcagtccaaaagacttcaaaattacaattgggaagattaatgatcagtttgcagga
tatagccagcaagactcccaggagctgcttctcttcctaatggacggcttgcacgaagac
ctcaataaagctgacaacaggaagagatacaaggaagaaaacaacgatcatcttgatgac
ctcagagcagcagaactagcctggcagaagcacaaacagctcaacgaatccattattgtg
gcactcttccaaggccagttcaaatcaacagtgcagtgtctcacatgtcacaagaagtcc
cggacctttgaggcgttcatgtatttgtccttaccacttgcatccaccagtaaatgcaca
ctgcaggaatgccttagattgttctccaaagaggaaaagctcaccgacaacaacagattt
tactgtagccattgcaaaactcgaagggattctttgaaaaaaatagaaatttggaaatta
ccacctgtgcttctcgtgcacctgaaacgattttcctatgatggaagatggaagcaaaag
cttcagacctctgtagatttcccattggaaactcttgatctttcacagtatgttatcggt
ccaaagaataatttgaagagatacaatctattttcagtatcaaatcattatggtgggttg
gacggagggcactacaccgcctactgcaaaaatgcctcaaaacagcgctggtttaagttt
gatgaccatgaagtatctgagatctcagcatcatctgtgaaatcctcagctgcatatatt
ctcttttacacttcttatgaacaacgagcagtggatatggccacataa

DBGET integrated database retrieval system