KEGG   Meleagris gallopavo (turkey): 664713Help
Entry
664713            CDS       T01523                                 

Gene name
PLCB2
Definition
(RefSeq) phospholipase C beta 2
  KO
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Gap junction
NOD-like receptor signaling pathway
GnRH signaling pathway
Melanogenesis
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    664713 (PLCB2)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    664713 (PLCB2)
   04020 Calcium signaling pathway
    664713 (PLCB2)
   04070 Phosphatidylinositol signaling system
    664713 (PLCB2)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    664713 (PLCB2)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    664713 (PLCB2)
  Endocrine system
   04912 GnRH signaling pathway
    664713 (PLCB2)
   04916 Melanogenesis
    664713 (PLCB2)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    664713 (PLCB2)
   04270 Vascular smooth muscle contraction
    664713 (PLCB2)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    664713 (PLCB2)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     664713 (PLCB2)
Membrane trafficking [BR:mgp04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    664713 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    664713 (PLCB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
5
AA seq 1211 aa AA seqDB search
MSMLTPVLQPPEVKEYLSRGERFIKWDDETASASPVILRVDPKGFYLYWTYQNKEMEILD
ITSIRDTRVGRFAKIPKCQKLREVFNLDYPHSTFLLKTLTIVSGPDMVDLTFHNFVSYKE
NVGKSWAEDIMAIVQNPLTYNASRYTFLEKILVKLKMQLNAEGKIPVRNIFQMFPADRKR
VEAALNACHLPKGKNDAINPEDFPETVYKTFLMNLCPRPEIDEIFTSHHFKAKPYMTKEH
LAKFINKKQRDSRLNDILFPPAKPEQVQSLIEKYEPSVINIQRGQLSPEGMVWFLCGPEN
NVIALDKLVLYQDMTQPLSHYFINSSHNTYLTAGQFSGISSPEMYRQTLLAGCRCVELDC
WKGRPPDEEPIITHGFTMTTEILFKDAIEAIAESAFKTSLYPVILSFENHVDSPKQQAKM
AEYCRTIFGDMLLTEPLEKYPLKPGVPLPSPKDLLGKILIKNKKKQFVSEKRQSSMKKGK
NVEPEIIEQPAFTDAEDTVWAGDVAEEEPEEEDDQLGNLDEEEIKKMQSDEGTAGLEVTA
YEEMSSLVNYIQPIKFDSFEVSAQKNRSYVISSFTELKAYDLLTKFPMQFVEYNKRQMSR
IYPKGTRMDSSNYMPQMFWNVGCQMVALNFQTMDVPMQQNMALFEFNGQCGYLLKHEFMR
RPDKQFDPFSVDRIDVVVASTVSVTILSGQFLSDRSVKTYVEVELFGLPRDTKRKYRTKL
TSTANSINPVWKEEPFVFEKIVMPELASLKIVAFEEGGKFIGHRVIPIIAVHSGYHHVCL
RSESNMPLTMPSLFVYLEVKDYVPDAWADLTIALSNPIKFFNLQEKRSVNLKDGSEVERP
DMQRNFSFPENNGIPESTRIFSTPFANGPAGAAALVKDGNMKEVTQLPEPQTASLAELQQ
MKLFLKLLKKQEKELKELERKGSKRREELLQKYSVLFLEPVYPRGKKRSMHSRKTQKKRS
LTTGDVGTCMQPVEMAEKLDSQVVELKERLEMELIHLGEEYHDGIRRRKEQHATEQTAKI
TELAREKQIAELKALKESSESNIKDIKKKLEAKRLDRIQVMMRSTSDKAAQERLKKEINN
SHIQEVVQTIKLLTEKTARYQQKLEEKQAENLRAIQEKEGQLQQEAVAEYEEKLKTLTVE
VQEMVKNYMKEVFPDGPEIQKEAVLSIPVEEQGSTKQLEEKIPGAEVPRLTAATTEPPGA
ETDINIEESIL
NT seq 3636 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgcttactcctgtcctgcagcccccagaggtgaaggagtatctgtccaggggc
gagcgcttcatcaaatgggacgatgaaacagcaagtgcttctcctgtgattcttcgggtg
gatccaaagggcttttatttatactggacgtatcagaacaaggagatggaaattctggat
ataaccagcatccgagatacccgagtagggcgatttgccaaaatccccaagtgccagaag
ctccgcgaggtttttaacttggattaccctcacagcacctttctgctgaaaactctgacg
attgtatctggccctgacatggtggacctcactttccataactttgtgtcctacaaggag
aatgttggcaagagctgggctgaggatattatggccattgttcagaatcctctcacatac
aacgcttcccggtacaccttcctagagaaaatcctggtgaagttgaagatgcagctgaat
gcagagggaaagattcctgtcaggaatatttttcagatgtttcctgcagacaggaagagg
gtggaagcagcattaaatgcttgtcatcttccaaaaggcaagaatgatgccatcaaccca
gaggacttccctgagactgtgtataaaactttcctcatgaatctgtgtccacggcctgag
attgatgagatatttacttcacaccatttcaaagcaaaaccctacatgaccaaagaacac
ttggcaaagtttatcaacaagaagcagcgagactctcgcctcaatgacatccttttccca
ccagcaaaacctgagcaggtgcagagcctgatagagaaatatgagcccagcgtcattaac
atccagagagggcagttgtctccggagggaatggtctggtttctctgcggccctgagaac
aatgtaatagcactggacaaattggtgctgtatcaggacatgacacagccactctcacac
tacttcatcaattcatcgcacaacacttatttaacagctggccagttttctggtatctca
tctcccgaaatgtaccgtcagacgctgctagctgggtgtcgctgtgtggagctggactgc
tggaagggccgtcccccagatgaggagcccatcatcactcacggattcaccatgacaact
gaaatcctcttcaaggatgcaattgaggccattgcagaaagtgctttcaaaacatctctt
taccctgtcatcctctcttttgagaaccacgtggactcgcccaagcagcaggcaaagatg
gctgagtactgccgaaccatatttggagatatgctgctgacagagcctctggagaaatac
ccactgaagccaggagttcctctgccaagtcctaaggatctcttagggaaaatcctaatt
aagaacaaaaagaaacagtttgtatctgagaagaggcagagttctatgaagaagggaaag
aacgtggaaccagaaatcattgagcagccagcttttaccgatgctgaagatactgtctgg
gcaggtgatgtggctgaggaagaaccagaggaagaggatgatcagctaggaaacctggat
gaagaggaaatcaaaaagatgcagtcagatgagggcactgctggtttggaagtaacagcg
tatgaggaaatgtccagcctcgttaattacatacagcccatcaaatttgactcctttgaa
gtctctgcccagaagaaccggagttacgtaatttcttccttcactgagctgaaggcttat
gatctgctgaccaagttccctatgcagtttgtagaatacaacaaacgccagatgagccgg
atttaccccaaaggcacccggatggactcctcgaattacatgccccagatgttctggaac
gttggctgtcagatggtggcactgaacttccagaccatggatgttcccatgcagcagaac
atggctctgtttgagttcaatggccagtgtggctatctgctcaagcacgaattcatgcgg
cgtccagacaagcaatttgaccctttctcagtggaccgcattgatgtggtggtggcaagc
acagtgtctgtcacgatactttctggtcagttcctctcagaccgcagtgtgaagacatat
gtggaagtggagctgtttgggttgccaagggacacgaagcgcaaatacagaaccaaactg
acctccactgccaattccataaatcctgtttggaaagaagaaccttttgtttttgaaaag
atcgtgatgcctgagctggcatcactcaaaattgtggcttttgaggaaggagggaagttc
attggtcaccgtgtcattcccattattgcagtgcactcaggctatcaccatgtttgtctc
cgcagtgaaagtaacatgccactcaccatgccctctctatttgtgtacctggaagtaaag
gattacgtccctgatgcctgggcagatctgactattgctctctccaacccaattaagttc
ttcaatctgcaagaaaagagatcagttaatctaaaagatggctcagaggtggagaggcct
gacatgcagaggaacttttcatttcctgaaaataatgggataccagaatccaccaggata
ttcagcactccttttgcaaacgggcctgcaggagcagcagctctggtcaaggatggaaac
atgaaggaagtgacacagcttccagagcctcagacagccagccttgcagaactgcagcag
atgaagctgttcctgaagctgctgaagaagcaggagaaagagctgaaggagctggagcgg
aagggaagtaaacggagagaagagttgctacagaaatactctgttctctttttggaacct
gtctaccccagaggcaaaaaaagatccatgcactccaggaaaacccagaagaagaggagt
ttgacgacaggtgatgttggtacctgcatgcaacctgtagaaatggcagaaaagcttgat
agccaagttgtggaactgaaagagaggctggagatggagcttatccacctgggggaagaa
taccatgatggaattcgaagaaggaaagagcagcatgccacagagcaaacggccaagatt
acagagctagccagagagaagcagatagctgagctgaaggcactgaaggagtcatcagaa
agcaacattaaagacattaagaagaagctggaggcgaaacgattagacagaatccaagtc
atgatgaggagtactagcgacaaggctgctcaggagaggttgaagaaagaaattaataac
tctcacatccaggaagtggtccaaacaatcaaactgctgacagaaaagacagccaggtat
cagcagaagctggaagagaaacaggcagagaatctgagagcaattcaagagaaagaaggc
cagctccaacaggaggcagtggcagaatacgaggagaaattgaaaactctgactgtggag
gtgcaggagatggtaaagaactatatgaaagaagtctttcctgatgggccagagattcaa
aaggaagcagttctgagcattcctgtagaagaacaaggttctacaaagcaactggaagag
aagatcccaggggcagaggtgccaagactgacagcagctacgactgagcctccaggagct
gaaacagacatcaatattgaggaaagcatactgtga

DBGET integrated database retrieval system