KEGG   Meleagris gallopavo (turkey): 664714Help
Entry
664714            CDS       T01523                                 

Gene name
CYP1A5
Definition
cytochrome P450, family 1, subfamily A, polypeptide 5
Orthology
K07408  
cytochrome P450, family 1, subfamily A, polypeptide 1 [EC:1.14.14.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    664714 (CYP1A5)
  Amino acid metabolism
   00380 Tryptophan metabolism
    664714 (CYP1A5)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    664714 (CYP1A5)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    664714 (CYP1A5)
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     664714 (CYP1A5)
Cytochrome P450 [BR:mgp00199]
 Cytochrome P450, animal type
  CYP1 family
   664714 (CYP1A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 528 aa AA seqDB search
MGPEEVMVQVGSPGLISATEMLVAAATFCLLLLLTQTRRQHTPKGLRRPPGPRGLPLLGS
VLELRKDPHLVLTQMSRKYGDVMEVTIGSRPVVVLSGLETIKQALVRQAEDFMGRPDLYS
FRHVTDGQSLTFSTDTGEVWKARRKLAQNALXXXXXXXXPTASSSCLLEEHVTNEASYLV
TKFLQLMEEKQSFDPYRYMVVSVANVICAICFGKRYDHDNQELLSVVNVVEEFGDVTAVG
NPTDFIPLLQYLPSRNMDLFLDFNKRFMKLLKTAVEEHYETFDKNNIRDVTDSLIEQCME
KKTEANSATQIPNEKIINLVNDIFGAGFDTVTTALSWSLMYLVTYPHIQKKIQAELDQTI
GRERRPRLSDRGTLPYTEAFILEMFRHSSFMPFTIPHSTTRDTVLNGYYIPKDRCVFINQ
WQVNHDEKLWKDPQAFNPERFLNAEGTEVNKVDAEKVMTFGLGKRRCIGENIGKWEVFLF
LSTLLQQLEFSIRDGKKADMTPIYGLSVKHKRCEHFQVKKRFSMKSSN
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggggccggaggaagtgatggtacaggtgggcagcccaggtctcatctcggccaccgag
atgctggtggcagctgccactttctgcctgctcctgctgctgacccagacccgccggcag
cacacacccaaggggctgcgcagacccccgggtccccgtgggctcccactgctgggcagt
gtgctggagctgaggaaggacccacacctggtgctcacccagatgagccgcaaatacggg
gatgtgatggaggtgaccatcggctcccggcccgtggtggtgctcagcgggctggaaacc
atcaagcaagccttggtgaggcaagcagaagacttcatgggacgccccgacctctacagc
tttcgacacgttacggacggacagagcctgaccttcagcactgacacgggggaagtgtgg
aaagcccgtaggaagctggcacagaacgccctnnnnnnnnnnnnnnnnnnnnnnnnnccc
acagcctcctccagctgcctcctggaggagcacgtcaccaacgaggccagctacctggtc
accaaattcctgcagctgatggaggagaagcagagctttgacccctaccgctacatggtg
gtgtcggtggccaacgtcatctgcgccatttgctttggcaagcgctacgaccacgacaac
caggagctgctcagcgtggtgaacgtggttgaggagttcggagatgtgactgctgttggc
aacccaactgacttcatcccattgctccagtacctccccagccgcaacatggatttattt
ctggatttcaacaagcgattcatgaaattgttgaagacagctgtggaagagcactacgag
acttttgacaagaacaacatccgagatgtcacggactccctcattgagcagtgcatggag
aaaaaaaccgaagccaacagtgccacacagatcccaaatgagaagatcatcaacctggtg
aatgacatctttggagcaggctttgacactgtgacaacggccctgtcctggagcctcatg
taccttgtgacatacccccacatccagaagaagattcaggcagagctggatcagaccatc
ggccgtgagaggagaccacggctgtccgaccgaggcacgctgccctacacagaagccttc
atcctggagatgttccggcactcctccttcatgcccttcaccatcccacacagcacgacc
agggacacggtgctgaatggctactatatcccaaaggaccgctgcgtgttcatcaaccag
tggcaagtgaatcacgatgagaaactttggaaggatccacaggctttcaacccagagcgt
ttcctcaatgctgaagggactgaagtgaacaaagtggatgcggagaaggtgatgactttt
ggcctggggaaaaggaggtgcattggggaaaacataggcaagtgggaggtgttccttttc
ctgtccacattgctccagcaactggagttcagcatccgcgatggcaagaaggcagacatg
acacctatatacggactgtctgtcaagcacaagagatgtgagcactttcaagtcaagaaa
cgcttctccatgaagagctcaaactga

DBGET integrated database retrieval system