KEGG   Meleagris gallopavo (turkey): 678669Help
Entry
678669            CDS       T01523                                 

Gene name
CYP3A37
Definition
(RefSeq) cytochrome P450 3A37
  KO
K07424  cytochrome P450 family 3 subfamily A [EC:1.14.14.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00140  Steroid hormone biosynthesis
mgp00591  Linoleic acid metabolism
mgp00830  Retinol metabolism
mgp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    678669 (CYP3A37)
   00591 Linoleic acid metabolism
    678669 (CYP3A37)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    678669 (CYP3A37)
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     678669 (CYP3A37)
Cytochrome P450 [BR:mgp00199]
 Cytochrome P450, animal type
  CYP3 family
   678669 (CYP3A37)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 678669
NCBI-ProteinID: NP_001290080
Ensembl: ENSMGAG00000003542
UniProt: Q1PCR1
Position
16
AA seq 504 aa AA seqDB search
MNLLPFFSIETWILLLIFVALLIAYGTWPFGLFKKLGIPGPRPLPFFGTCLEYRKGFLEF
DTECFKKYGKIWGIYDGRQPAVVVMDPQIIKTVLVKECYSTFTNRRRVDLAGELRNAVSL
AEDDQWKRLRTVLSPTFTSGKLKEMFPTMKHFGEMLVKNVQKRVEKDSSVPVKDFFGSYS
MDVVTSTSFGVNIDSMNNPKSPFVREMQKLTKFDFFDPLFILAFVCPFLTPLMAKMNVSF
FPSDAVDFFLRSIDKIKKDREKETHKGRVDFLQMMIESQKSDSDGKNSHKALSDIEVLSQ
AFIFIFAGYEPTSNTLCYLAYLLALHPDVQQKVVNEIDTILPNKAPLTYEAIMQLDYLDM
AVNETLRLYPLGGRIERTCKKDVEINGVTIPKETIVVIPPYTLHRNSEYWPNPEEFRPER
FSKENKDNIDPYTYLPFGAGPRNCIGMRFALLTLKVAITSILQHFTFQVCKETQIPLKLL
SMGLMTPEKPIILKLVPRTNNAKA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttcttcctttcttctccattgaaacctggatcctcttgcttatttttgtagcc
ctcctgatagcatatggaacatggccatttgggctgttcaagaagctgggcattcctggg
ccaagacctctgcctttctttgggacgtgcctggaataccgtaaaggcttcttggaattt
gacactgagtgcttcaagaagtatgggaaaatctgggggatttacgatggcaggcagcct
gcagtggttgtcatggacccccagatcatcaaaaccgtgctggtgaaagagtgctactcc
accttcaccaaccgcaggcgcgtagatctagcaggggagctgagaaatgctgtctcatta
gctgaagacgatcagtggaaaaggctccgtactgtgctctctccaaccttcaccagtggg
aagctaaaggagatgtttcctacaatgaagcactttggggagatgttggtgaaaaatgtt
caaaagagggtggaaaaggacagctctgtccctgtgaaggacttctttggaagctacagc
atggatgtagtcaccagcacttccttcggtgtgaacatcgactccatgaacaaccctaaa
agcccctttgtcagagagatgcagaaactgaccaagtttgatttttttgatccactcttc
atcttggcatttgtatgcccattccttacccctcttatggccaagatgaacgtcagcttt
ttcccaagtgatgctgtagatttcttcctgaggtctattgacaaaattaagaaggaccgt
gaaaaggagactcacaagggcagagtagattttctgcagatgatgatcgaatcccagaaa
tcagacagcgatgggaagaactcacataaagccctgagtgacatagaggtcctgtcacaa
gcattcatcttcatttttgctggctatgagcccaccagtaacacactttgttacctggct
tacctgctggccttgcatcctgatgtacagcagaaggtggtgaatgaaatagataccatt
ctacccaacaaggctccgctcacatatgaagcgataatgcagttggattaccttgacatg
gccgtgaatgaaaccctccggctctatcccctcggaggacggattgagagaacctgcaag
aaagatgtggaaataaacggggtgaccattccaaaagaaaccattgtcgttatcccacct
tacaccctgcaccgcaactccgagtactggccaaacccagaggagttcagaccagaaagg
ttcagtaaggaaaacaaagacaacatagacccatacacatacctgccttttggagctggt
cccaggaactgcattgggatgcgatttgctctcttgactctgaaagttgccatcacttcc
atattgcagcacttcaccttccaggtctgcaaagaaactcagatccctctcaagctgctc
tcgatgggactcatgactccagagaagcccatcattctcaagttagtccctcggaccaac
aatgccaaggcatag

DBGET integrated database retrieval system