KEGG   Meleagris gallopavo (turkey): 678669Help
Entry
678669            CDS       T01523                                 

Gene name
CYP3A37
Definition
cytochrome P450 3A37
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:mgp00140]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:mgp00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:mgp00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
16
AA seq 504 aa AA seqDB search
MNLLPFFSIETWILLLIFVALLIAYGTWPFGLFKKLGIPGPRPLPFFGTCLEYRKGFLEF
DTECFKKYGKIWGIYDGRQPAVVVMDPQIIKTVLVKECYSTFTNRRRVDLAGELRNAVSL
AEDDQWKRLRTVLSPTFTSGKLKEMFPTMKHFGEMLVKNVQKRVEKNSSVPVKDFFGSYS
MDVVTSTSFGVNIDSMNNPKSPFVREMQKLTKFDFFDPLFILAFVCPFLTPLMAKMNVSF
FPSDAVDFFLRSIDKIKKDREKETHKGRVDFLQMMIESQKSDSDGKNSHKALSDIEVLSQ
AFIFIFAGYEPTSNTLCYLAYLLALHPDVQQKVVNEIDTILPNKAPLTYEAIMQLDYLDM
AVNETLRLYPLGGRIERTCKKDVEINGVTIPKETIVVIPPYTLHRNSEYWPNPEEFRPER
FSKENKDNIDPYTYLPFGAGPRNCIGMRFALLTLKVAITSILQHFTFQVCKETQIPLKLL
SMGLMTPEKPIILKLVPRTNNAKA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttcttcctttcttctccattgaaacctggatcctcttgcttatttttgtagcc
ctcctgatagcatatggaacatggccatttgggctgttcaagaagctgggcattcctggg
ccaagacctctgcctttctttgggacgtgcctggaataccgtaaaggcttcttggaattt
gacactgagtgcttcaagaagtatgggaaaatctgggggatttacgatggcaggcagcct
gcagtggttgtcatggacccccagatcatcaaaaccgtgctggtgaaagagtgctactcc
accttcaccaaccgcaggcgcgtagatctagcaggggagctgagaaatgctgtctcatta
gctgaagacgatcagtggaaaaggctccgtactgtgctctctccaaccttcaccagtggg
aagctaaaggagatgtttcctacaatgaagcactttggggagatgttggtgaaaaatgtt
caaaagagggtggaaaagaacagctctgtccctgtgaaggacttctttggaagctacagc
atggatgtagtcaccagcacttccttcggtgtgaacatcgactccatgaacaaccctaaa
agcccctttgtcagagagatgcagaaactgaccaagtttgatttttttgatccactcttc
atcttggcatttgtatgcccattccttacccctcttatggccaagatgaacgtcagcttt
ttcccaagtgatgctgtagatttcttcctgaggtctattgacaaaattaagaaggaccgt
gaaaaggagactcacaagggcagagtagattttctgcagatgatgatcgaatcccagaaa
tcagacagcgatgggaagaactcacataaagccctgagtgacatagaggtcctgtcacaa
gcattcatcttcatttttgctggctatgagcccaccagtaacacactttgttacctggct
tacctgctggccttgcatcctgatgtacagcagaaggtggtgaatgaaatagataccatt
ctacccaacaaggctccgctcacatatgaagcgataatgcagttggattaccttgacatg
gccgtgaatgaaaccctccggctctatcctctcggaggacggattgagagaacctgcaag
aaagatgtggaaataaacggggtgaccattccaaaagaaaccattgtcgttatcccacct
tacaccctgcaccgcaactccgagtactggccaaacccagaggagttcagaccagaaagg
ttcagtaaggaaaacaaagacaacatagacccatacacatacctgccttttggagctggt
cccaggaactgcattgggatgcgatttgctctcttgactctgaaagttgccatcacttcc
atattgcagcacttcaccttccaggtctgcaaagaaactcagatccctctcaagctgctc
tcgatgggactcatgactccagagaagcccatcattctcaagttagtccctcggaccaac
aatgccaaggcatag

DBGET integrated database retrieval system