KEGG   Meleagris gallopavo (turkey): 678669Help
Entry
678669            CDS       T01523                                 

Gene name
CYP3A37
Definition
cytochrome P450 3A37
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    678669 (CYP3A37)
   00591 Linoleic acid metabolism
    678669 (CYP3A37)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    678669 (CYP3A37)
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     678669 (CYP3A37)
Cytochrome P450 [BR:mgp00199]
 Cytochrome P450, animal type
  CYP3 family
   678669 (CYP3A37)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
16
AA seq 504 aa AA seqDB search
MNLLPFFSIETWILLLIFVALLIAYGTWPFGLFKKLGIPGPRPLPFFGTCLEYRKGFLEF
DTECFKKYGKIWGIYDGRQPAVVVMDPQIIKTVLVKECYSTFTNRRRVDLAGELRNAVSL
AEDDQWKRLRTVLSPTFTSGKLKEMFPTMKHFGEMLVKNVQKRVEKNSSVPVKDFFGSYS
MDVVTSTSFGVNIDSMNNPKSPFVREMQKLTKFDFFDPLFILAFVCPFLTPLMAKMNVSF
FPSDAVDFFLRSIDKIKKDREKETHKGRVDFLQMMIESQKSDSDGKNSHKALSDIEVLSQ
AFIFIFAGYEPTSNTLCYLAYLLALHPDVQQKVVNEIDTILPNKAPLTYEAIMQLDYLDM
AVNETLRLYPLGGRIERTCKKDVEINGVTIPKETIVVIPPYTLHRNSEYWPNPEEFRPER
FSKENKDNIDPYTYLPFGAGPRNCIGMRFALLTLKVAITSILQHFTFQVCKETQIPLKLL
SMGLMTPEKPIILKLVPRTNNAKA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttcttcctttcttctccattgaaacctggatcctcttgcttatttttgtagcc
ctcctgatagcatatggaacatggccatttgggctgttcaagaagctgggcattcctggg
ccaagacctctgcctttctttgggacgtgcctggaataccgtaaaggcttcttggaattt
gacactgagtgcttcaagaagtatgggaaaatctgggggatttacgatggcaggcagcct
gcagtggttgtcatggacccccagatcatcaaaaccgtgctggtgaaagagtgctactcc
accttcaccaaccgcaggcgcgtagatctagcaggggagctgagaaatgctgtctcatta
gctgaagacgatcagtggaaaaggctccgtactgtgctctctccaaccttcaccagtggg
aagctaaaggagatgtttcctacaatgaagcactttggggagatgttggtgaaaaatgtt
caaaagagggtggaaaagaacagctctgtccctgtgaaggacttctttggaagctacagc
atggatgtagtcaccagcacttccttcggtgtgaacatcgactccatgaacaaccctaaa
agcccctttgtcagagagatgcagaaactgaccaagtttgatttttttgatccactcttc
atcttggcatttgtatgcccattccttacccctcttatggccaagatgaacgtcagcttt
ttcccaagtgatgctgtagatttcttcctgaggtctattgacaaaattaagaaggaccgt
gaaaaggagactcacaagggcagagtagattttctgcagatgatgatcgaatcccagaaa
tcagacagcgatgggaagaactcacataaagccctgagtgacatagaggtcctgtcacaa
gcattcatcttcatttttgctggctatgagcccaccagtaacacactttgttacctggct
tacctgctggccttgcatcctgatgtacagcagaaggtggtgaatgaaatagataccatt
ctacccaacaaggctccgctcacatatgaagcgataatgcagttggattaccttgacatg
gccgtgaatgaaaccctccggctctatcctctcggaggacggattgagagaacctgcaag
aaagatgtggaaataaacggggtgaccattccaaaagaaaccattgtcgttatcccacct
tacaccctgcaccgcaactccgagtactggccaaacccagaggagttcagaccagaaagg
ttcagtaaggaaaacaaagacaacatagacccatacacatacctgccttttggagctggt
cccaggaactgcattgggatgcgatttgctctcttgactctgaaagttgccatcacttcc
atattgcagcacttcaccttccaggtctgcaaagaaactcagatccctctcaagctgctc
tcgatgggactcatgactccagagaagcccatcattctcaagttagtccctcggaccaac
aatgccaaggcatag

DBGET integrated database retrieval system