KEGG   Meleagris gallopavo (turkey): 692129Help
Entry
692129            CDS       T01523                                 

Gene name
ACR, Proacro1
Definition
acrosin
Orthology
K01317  
acrosin [EC:3.4.21.10]
Organism
mgp  Meleagris gallopavo (turkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 382 aa AA seqDB search
MSSNETKRPFYSPNRTCGPGLRPQGHPARNPVTRCALQRPLVAAESTAAHRWHITVTEWP
GTCGLRPVAYHYGGMRVVGGTEALHGSWPWIVSIQNPRFAGTGHMCGGSLITPQWVLSAA
HCFGRPNYILQSRVVIGANDLTQLGQEVEVRSIRRAILHEYFNNKTMINDIALLELDRPV
HCSYYIQLACVPDPSLRVSELTDCYVSGWGHMGMRSAAPTQTAEVLQEAKVHLLDLNLCN
SSHWYDGVLHSHNLCAGYPQGGIDTCQGDSGGPLMCRDSSADYFWLVGVTSWGRGCGRAF
RPGIYTSTQHFYNWILLQMRAAAHPTSRTWSHYMSTSSYHHGPNAVPTQPSVSDSCPFPA
QKLREFFTGVQNLLQSLWGSKA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagctccaacgagaccaagcgccctttctactctccgaaccgaacctgcgggccgggg
ctgcgcccccagggacacccagcccgcaaccctgtaacccgctgtgcgctgcagcgcccc
ctggtggcggcggagagcactgcagcgcaccgctggcatatcacagtgacagaatggcct
ggcacctgcgggctccggcccgtggcttatcactatggtgggatgcgcgtcgtgggcggc
acggaagccctgcacgggtcctggccgtggatcgtcagcatccagaacccccggtttgcg
ggcacgggacacatgtgcggaggatccctcatcaccccgcagtgggtgctctcggcagcg
cactgcttcggccgccccaactacatcctgcagtcgcgcgtggtgatcggtgccaacgat
ctgactcagctgggccaggaggtggaggtgcgcagcatcaggagggcgatacttcacgag
tactttaacaacaagacgatgatcaacgacatcgcgctgctcgagttggatcgacccgtc
cactgcagctactacatccagctggcctgcgtgcccgacccctcgctgcgagtgtcagag
ctcacagactgctacgtcagtggctggggacacatggggatgagatctgcagcgcccacc
caaaccgccgaggtcctgcaggaggccaaggtccacctcctcgacctcaacctctgcaac
agcagccactggtacgacggggtgctccacagccacaacctgtgtgctggttacccgcag
ggcggcatcgacacctgccagggcgatagcggcggccctctgatgtgcagagacagcagc
gctgactatttctggctggttggtgtgaccagctgggggagaggctgcggcagggcgttt
cgccctgggatctacacctccactcagcacttctacaactggatcctgctgcagatgaga
gcagcagcccacccgacgtcgcggacatggagtcattacatgagcacctcgtcctaccac
cacgggccaaacgcggtgccaacacaaccgagcgtgtcggactcctgtccatttccagcc
cagaaactcagggaattctttactggggtgcagaacctcctgcagagcctttggggaagc
aaggcttaa

DBGET integrated database retrieval system