KEGG   Meleagris gallopavo (turkey): 780945Help
Entry
780945            CDS       T01523                                 

Gene name
PRKAA2
Definition
(RefSeq) protein kinase, AMP-activated, alpha 2 catalytic subunit (EC:2.7.11.1)
  KO
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    780945 (PRKAA2)
   04150 mTOR signaling pathway
    780945 (PRKAA2)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    780945 (PRKAA2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    780945 (PRKAA2)
   04920 Adipocytokine signaling pathway
    780945 (PRKAA2)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     780945 (PRKAA2)
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   780945 (PRKAA2)
Mitochondrial biogenesis [BR:mgp03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    780945 (PRKAA2)
  Mitophagy factors
   Other mitophagy factors
    780945 (PRKAA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 552 aa AA seqDB search
MAEKQQKHDGRVKIGHYVLGDTLGVGTFGKVKVGEHQLTGHKVAVKILNRQKIRSLDVVG
KIKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEAEARRL
FQQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNY
AAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNR
SVATLLMHMLQVDPLKRATIKDIREHEWFKEELPSYLFPEDPSYDATVIDDDAVREVCEK
FECTESEVMNSLYSGDPQDQLAVAYHLVIDNRRIMNQASEFYLASSPPTGSFMDDTMHIP
PGVKPHPERMPPLVADSPKARCPLDALNTTKPKPLTVKKAKWHLGIRSQSKPYDIMAEVY
RAMKQLDFEWKVVNSYHLRVRRKNPVTGNYVKMSLQLYQVDNRSYLLDFKSIDDEVMEQR
SGSSTPQRSCSAAGLHRPRLSIDAAAATECQSLMGSLSGSFVGSISSVPPRLGSHTMDFF
EMCASLIMALAR
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaagcagcagaagcacgacgggagggtgaagatcggccactacgtgctgggg
gatacgctgggggtcggcaccttcggcaaagtcaaggttggcgaacaccagttgacgggg
cacaaagtagcagtaaaaatcctaaacagacagaaaatacgcagcctggatgtggttggg
aagatcaaacgagaaattcaaaacctaaaactcttccggcaccctcatattatcaaactg
taccaggtcatcagcacgccaacggacttcttcatggtcatggaatatgtatccggtggt
gaattatttgattacatctgtaagcatggacgtgttgaagaggcggaggctcgacgcctt
ttccagcagattctctccgcagtggattactgtcaccgacacatggttgtccacagggac
ctgaaaccagagaacgtgctgctggacgcacacatgaatgcgaagatagccgattttgga
ttgtccaacatgatgtctgatggtgaatttctacgcaccagctgcggttccccaaattat
gcggcccctgaagtcatttctggaaggctgtatgctggtccagaggtggacatctggagc
tgcggcgtcatcctctatgccctcctctgtggcactttgccctttgatgatgagcatgtg
cccaccctcttcaagaagatccgtggaggtgtgttttacatccctgagtacctcaaccgc
tccgttgccactctgctcatgcacatgctgcaggttgaccctctcaagcgcgcaaccatc
aaggacatcagggaacacgagtggtttaaggaggagctgcccagctacctcttcccagag
gacccttcctacgatgccaccgtcatcgatgacgacgctgttcgggaggtctgtgagaag
tttgagtgcaccgagtcagaagtgatgaacagtctgtacagcggtgacccccaggaccaa
ctcgcggtcgcctaccaccttgtcatcgacaaccggaggatcatgaaccaagccagcgag
ttctacctagcctccagccccccaactggctccttcatggacgacaccatgcacatccct
cccggtgtgaagcctcaccccgagcggatgccacccttggtagcagacagccccaaggca
cgttgccctttggatgcactcaacaccaccaagcccaaacctctgactgtcaaaaaggcc
aagtggcacctggggatccgcagccagagcaagccctatgacattatggccgaggtgtac
cgagctatgaagcagttggattttgagtggaaggtggtgaactcctaccatctcagagtg
cgtcggaagaacccggtgacgggcaattatgtgaaaatgagtctgcaactgtaccaggtg
gacaaccgcagctacctcctggacttcaaaagcattgacgacgaggtgatggagcagagg
tccggctcatccaccccgcagcgctcgtgctcagcagctggcttgcaccggccaagattg
agcattgatgctgcagcagccactgagtgccagtcactgatggggtccctgagcggctcc
ttcgtgggcagcatctcctcagtgcccccacgcctgggcagccacaccatggacttcttc
gagatgtgtgccagtttgatcatggctctggctcgctga

DBGET integrated database retrieval system