KEGG   Mycoplasma genitalium M6282: CM3_00190Help
Entry
CM3_00190         CDS       T02210                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
mgq  Mycoplasma genitalium M6282
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgq00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CM3_00190
Enzymes [BR:mgq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CM3_00190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(39868..40509)
Genome map
AA seq 213 aa AA seqDB search
MGKYQPSFQAKKGWTEVICGPMFSGKTEKLLHKIKRWKIAKISVVIFKPIIDTRQTNIVK
SRNGEYDQAITINSPFEIYDHLVDKNYQIVAIDEAQFFSNEIIEVVTTLNEIGTNVIISG
LDTDFRAEPFGCIPQLLAIADVVNKLDAICNVCGSLAQRTQRLVNKNTNDNLVLIGDAEA
YEARCKLHHSFLTKKHVTVKTKNFKEQVQEKTQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaatatcaaccatcttttcaagccaaaaagggctgaactgaagttatttgtggc
ccaatgttttctggaaaaacagagaaattacttcacaaaataaaacggtgaaagatagcc
aaaatttcagttgttatcttcaaaccaataattgatactagacaaactaatattgtcaaa
tcacgcaacggtgaatatgatcaagcaataactattaattctccttttgagatctatgat
cacttagttgataaaaactaccaaattgttgccattgatgaagcacaattcttttcaaat
gagattatagaagttgttacaactctcaatgagataggaacaaatgtgattatttctggg
cttgatactgattttagagctgagccttttggttgtattccccaacttttagcaatagct
gatgtagttaataaacttgatgctatttgcaatgtttgtggtagtttagcacaacgaacc
caaagactagtaaataaaaatactaatgataaccttgtcttaattggtgatgcagaagct
tatgaagctagatgcaaactgcaccactcatttttaactaaaaagcacgttactgttaaa
accaaaaactttaaagaacaggtgcaggagaaaacccaataa

DBGET integrated database retrieval system