KEGG   Mycoplasma genitalium M6282: CM3_01450Help
Entry
CM3_01450         CDS       T02210                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mgq  Mycoplasma genitalium M6282
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CM3_01450
   00670 One carbon pool by folate
    CM3_01450
Enzymes [BR:mgq01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CM3_01450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
274295..274654
Genome map
AA seq 119 aa AA seqDB search
MGRKTYESLPKVFEKRTIFLLSKDQNYRFEEKGSEVKVINDFWPLIKSYQANKEKDLFIC
GGKSVYEQTINECDQLIVSIIKKKYKGDQFLKVDLSKFVLNEVVEFEEFNVNYYRKKQQ
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggggagaaaaacttacgaatcactccccaaggtatttgaaaaaagaacaatatttctc
ctttcaaaagatcaaaactaccgttttgaagaaaagggaagtgaagtgaaagttattaat
gatttttgaccactaattaaaagttaccaagcaaataaagaaaaggatttgtttatttgt
ggtggaaaaagtgtgtatgaacagaccattaatgaatgtgatcagttaattgtttcaatc
attaaaaagaagtataagggtgatcagtttttgaaggttgatctcagtaaatttgtactt
aatgaagttgtagagtttgaggaatttaatgttaattattatagaaagaaacaacaataa

DBGET integrated database retrieval system