KEGG   Mycoplasma genitalium M6282: CM3_01730Help
Entry
CM3_01730         CDS       T02210                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mgq  Mycoplasma genitalium M6282
Pathway
mgq00010  Glycolysis / Gluconeogenesis
mgq00020  Citrate cycle (TCA cycle)
mgq00620  Pyruvate metabolism
mgq01100  Metabolic pathways
mgq01110  Biosynthesis of secondary metabolites
mgq01120  Microbial metabolism in diverse environments
mgq01130  Biosynthesis of antibiotics
mgq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mgq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CM3_01730
   00020 Citrate cycle (TCA cycle)
    CM3_01730
   00620 Pyruvate metabolism
    CM3_01730
Enzymes [BR:mgq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CM3_01730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: AFQ03593
Position
complement(329340..330494)
Genome map
AA seq 384 aa AA seqDB search
MANEFKFTDVGEGLHEGKVTEILKQVGDQIKIDEALFVVETDKVTTELPSPFAGTISAIN
VKVGDVVSIGQVMAVIGEKTSTPIVEPKPQPTEEVTKVKEAGASVVGEIKVSDNLFPIFG
VKPHATPAVKDTKVASSTNITVETTQKPESKTEQKTIAISTMRKAIAEAMTKSHAIIPTT
VLTFYVNATKLKQYRESVNGYALSKYSMKISYFAFFVKAIVNALKKFPVFNASYDPDQNE
IVLNDDINVGIAVDTEEGLIVPNIKQAQTKSVVEIAQAIVDLANKARTKKIKLTDLNKGT
ISVTNFGSLGAAVGTPIIKYPEMCIVATGNLEERIVKVKNGIAVHTILPLTIAADHRWVD
GADVGRFGKEIAKQIEELIDLTVA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgagtttaaattcactgatgttggtgagggtttacatgaaggaaaagtaact
gaaatcttaaaacaagttggtgatcagatcaagatagatgaagctttatttgttgttgaa
actgataaagttacaaccgaattaccttctccttttgcaggtacaattagcgctattaat
gttaaagttggtgatgttgttagcattggtcaggtgatggcagttattggtgaaaagact
agtacaccaattgttgaaccaaaacctcaaccaactgaagaagtaactaaggtaaaagaa
gcgggggcttcagtagtaggggaaattaaggtttctgataacctctttcctatctttgga
gtaaaacctcatgcaactccagctgttaaagacactaaagttgcaagtagtactaacatt
actgtagaaacaacccaaaaaccagaaagtaaaactgaacagaaaaccattgctatctca
acaatgcgcaaagcgattgcagaagcaatgacaaagtcgcacgcaattatcccaaccact
gtattaactttttatgttaatgcaaccaagttaaaacaatatcgtgaaagtgttaatggt
tatgctttaagtaagtattccatgaaaatttcttactttgctttctttgttaaagcaatt
gttaatgcgcttaagaagttccctgtttttaacgctagttatgatcctgatcaaaacgaa
attgttttaaatgatgacattaatgtaggaattgctgttgatactgaagaaggtttaatt
gtccctaacattaagcaagcccaaaccaaatctgtggttgaaattgcccaagcaattgtt
gatttagctaacaaagctagaacaaaaaagattaagttgactgatttgaataaaggtact
atttcagttactaacttcggttcattaggagcagctgtaggtacacctattattaagtac
cctgagatgtgtattgttgctactggtaatttagaagaacgcattgttaaagtgaaaaat
ggaattgcagttcataccatcttacctttaacaatagctgcagaccaccgctgggttgat
ggggcggatgttggtaggtttggtaaggagattgcaaaacaaattgaggaattaattgat
cttacagtagcttaa

DBGET integrated database retrieval system