KEGG   Mycoplasma genitalium M6282: CM3_02670Help
Entry
CM3_02670         CDS       T02210                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mgq  Mycoplasma genitalium M6282
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mgq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CM3_02670
   01230 Biosynthesis of amino acids
    CM3_02670
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CM3_02670
   00051 Fructose and mannose metabolism
    CM3_02670
   00562 Inositol phosphate metabolism
    CM3_02670
Enzymes [BR:mgq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CM3_02670
Exosome [BR:mgq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CM3_02670
  Exosomal proteins of bladder cancer cells
   CM3_02670
  Exosomal proteins of melanoma cells
   CM3_02670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(536992..537726)
Genome map
AA seq 244 aa AA seqDB search
MRTRYLIGNWKTNKNLKDAVSFVEQFQQNKLNYNAKIGIASVYVHLTEIKKIISDSLLLF
AQDANFIESGSYTGTVSFTQLQDIGVNNSIIGHSERRKYYNETSAVINQKLFACLKASMQ
VVLCIGEALGQEISFLKTDLTNCLNTIDKSLIKNLVIAYEPLWAIGTGKTATPEVANQTI
KTIRQYINDLYDENVANNISILYGGSVDHNNIQKLAIMEQIDGFLVGKASLEIKNFLEMA
RVYA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacaaggtatttaattggcaattggaaaacaaataaaaatttaaaagacgcagtt
agttttgttgaacaatttcaacaaaataaacttaattacaatgccaaaattgggatagca
tctgtttatgttcatctcactgaaataaaaaaaataattagtgatagtctccttttattt
gcccaagacgctaactttattgaaagtggttcatatactggaactgtaagctttactcaa
cttcaagacattggtgttaacaacagtattattggtcattctgaaagaagaaaatactat
aacgaaaccagtgcagttattaatcaaaagctctttgcttgtctaaaagcatccatgcaa
gtagttttatgtattggtgaggctttaggacaagagattagctttcttaaaactgatctt
actaattgcttaaatacgattgacaaaagcttaattaaaaatttagttattgcttatgag
cctttgtgagcaattggaacaggtaaaacagcaactcctgaagttgcaaatcaaaccatt
aaaaccattaggcaatatattaatgacttatatgatgaaaatgttgctaacaatatctca
attctatatggcggatcagttgatcataataatatccaaaaactagcaataatggaacaa
attgatggatttttagttggtaaagcatctttagaaattaaaaactttttagaaatggct
agggtatatgcataa

DBGET integrated database retrieval system