KEGG   Mycoplasma genitalium M6282: CM3_02670Help
Entry
CM3_02670         CDS       T02210                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mgq  Mycoplasma genitalium M6282
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mgq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CM3_02670
   01230 Biosynthesis of amino acids
    CM3_02670
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CM3_02670
   00051 Fructose and mannose metabolism
    CM3_02670
   00562 Inositol phosphate metabolism
    CM3_02670
Enzymes [BR:mgq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CM3_02670
Exosome [BR:mgq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CM3_02670
  Exosomal proteins of bladder cancer cells
   CM3_02670
  Exosomal proteins of melanoma cells
   CM3_02670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(536992..537726)
Genome map
AA seq 244 aa AA seqDB search
MRTRYLIGNWKTNKNLKDAVSFVEQFQQNKLNYNAKIGIASVYVHLTEIKKIISDSLLLF
AQDANFIESGSYTGTVSFTQLQDIGVNNSIIGHSERRKYYNETSAVINQKLFACLKASMQ
VVLCIGEALGQEISFLKTDLTNCLNTIDKSLIKNLVIAYEPLWAIGTGKTATPEVANQTI
KTIRQYINDLYDENVANNISILYGGSVDHNNIQKLAIMEQIDGFLVGKASLEIKNFLEMA
RVYA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacaaggtatttaattggcaattggaaaacaaataaaaatttaaaagacgcagtt
agttttgttgaacaatttcaacaaaataaacttaattacaatgccaaaattgggatagca
tctgtttatgttcatctcactgaaataaaaaaaataattagtgatagtctccttttattt
gcccaagacgctaactttattgaaagtggttcatatactggaactgtaagctttactcaa
cttcaagacattggtgttaacaacagtattattggtcattctgaaagaagaaaatactat
aacgaaaccagtgcagttattaatcaaaagctctttgcttgtctaaaagcatccatgcaa
gtagttttatgtattggtgaggctttaggacaagagattagctttcttaaaactgatctt
actaattgcttaaatacgattgacaaaagcttaattaaaaatttagttattgcttatgag
cctttgtgagcaattggaacaggtaaaacagcaactcctgaagttgcaaatcaaaccatt
aaaaccattaggcaatatattaatgacttatatgatgaaaatgttgctaacaatatctca
attctatatggcggatcagttgatcataataatatccaaaaactagcaataatggaacaa
attgatggatttttagttggtaaagcatctttagaaattaaaaactttttagaaatggct
agggtatatgcataa

DBGET integrated database retrieval system