KEGG   Mycoplasma genitalium M6282: CM3_02785Help
Entry
CM3_02785         CDS       T02210                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mgq  Mycoplasma genitalium M6282
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CM3_02785
   00052 Galactose metabolism
    CM3_02785
   00500 Starch and sucrose metabolism
    CM3_02785
   00520 Amino sugar and nucleotide sugar metabolism
    CM3_02785
Enzymes [BR:mgq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CM3_02785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
555872..556750
Genome map
AA seq 292 aa AA seqDB search
MKTKIRKAVIPAAGLGVRLLPATKAIPKEMLPLVNKPTIQYIVEEAVKSGIEQILVIVSS
KKTAILDHFDYDLILENALIQKNKLQEHKEIEDIANLAHIFFVRQKNQDGLGDAILFAES
FVGNEDFAVLLGDDVVFSKEPALKQCLEAYYETNCQTIGVQEVDPCHVDKYGIITPEGDY
KNKDLIKVLAMTEKPKPKDAKSNLAILGRYVLKPSIFKALRSVPYGVGGELQLTDGLNFC
LKNENFYARKFTGTRFDVGTKSGFIKANLFTALNNKDISKKEVLELLNLVKA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaaaataagaaaagcagttattcctgctgctgggttgggtgttaggttacta
ccagcaacaaaagcaattcccaaagagatgttaccattggtaaataaacctactatccaa
tacatagtagaggaagcagttaaaagtggcattgaacagattcttgtcattgtttcatcc
aaaaaaacagctatattagatcattttgattatgatctgatcttagaaaatgccttaatt
caaaaaaataaattgcaggagcataaagagattgaagatattgctaatttagcacatatc
ttttttgttagacaaaaaaatcaagatggtttgggagatgcaatcttgtttgctgaatct
tttgttggtaatgaagactttgcagtattgttaggtgatgatgttgtttttagtaaagaa
cctgctttaaaacaatgcttggaagcttattatgaaactaattgtcaaacaatcggtgta
caagaagtagatccttgtcatgttgataagtatggaattatcacccctgaaggtgattac
aaaaataaagatcttattaaggttttagcaatgactgaaaaacctaaaccaaaagatgct
aaaagtaatttagcaatcttagggcgatatgtactcaaaccatctattttcaaagcactt
agaagtgtaccttatggagttggtggtgagttgcagctaactgatggtttaaatttttgt
ttgaaaaatgaaaacttttatgcaagaaagtttactggtactaggtttgatgttggcaca
aagagtggttttattaaagcaaatttatttactgctttaaacaataaagatattagtaaa
aaagaagttttagaacttttaaatttagttaaagcttaa

DBGET integrated database retrieval system