KEGG   Magnaporthe oryzae: MGG_00015Help
Entry
MGG_00015         CDS       T01027                                 

Definition
catechol O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mgr  Magnaporthe oryzae
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:mgr00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 266 aa AA seqDB search
MSITLNAQDFTGVAYAEQEEVYFNDGREKELLDYVLNHPSVSEIRGHPQRVLDVIDEFGR
NQKYLMNIGEYKGRTVREIIYKHKPATMVELGGYVGYSAVAFAAAAREAGGERYISIEHN
PYFAHVIEKMVELAGLKEFVTVVVGDSTEALKGLHNNGTLKHIDLLFLDHLKPLYTQDLQ
LCEELELVGPGTVLAADNVVKPGNPPYLRYVRSTVAEKRDAKAKAMHMDATGNPNLIYES
QFVEGWEPSGVPDALEITHCVGIESY
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcaccctcaatgcccaagactttacaggcgtggcctacgcagaacaagaggaa
gtctacttcaacgatggccgcgaaaaggagcttttggactatgtcctcaaccacccatca
gtgtcagaaataaggggccacccacagagggtcctcgacgtgattgacgagtttggccgc
aatcaaaagtatctgatgaacattggggagtacaaaggcaggacagtccgcgaaatcatc
tacaagcacaagccggcgaccatggtagagcttggagggtacgttggctactcggctgtt
gcctttgcggctgctgccagagaagccggtggcgagcgatatatcagcatcgagcataac
ccttactttgcccacgtcattgagaagatggttgagcttgctggactgaaggagtttgta
actgttgtggtgggcgacagcacggaggcgttgaagggactacacaacaacgggacgctc
aagcacattgatttgttgtttctggatcatctcaagccgctctatacgcaggatctgcag
ctatgtgaggagctggagcttgttgggcctggcaccgtcctcgctgctgataacgtggtc
aagcctggcaacccgccgtatttgcgatacgttagaagtaccgtggccgagaagcgcgat
gcaaaggccaaagcgatgcacatggacgccacaggtaacccgaacctcatatacgagagc
caattcgtggaaggatgggagcccagtggagtacctgatgctctagagattacccattgt
gttggtattgagagctattga

DBGET integrated database retrieval system