KEGG   Magnaporthe oryzae: MGG_00063Help
Entry
MGG_00063         CDS       T01027                                 

Definition
glycogen debranching enzyme
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
mgr  Magnaporthe oryzae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mgr00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 1588 aa AA seqDB search
MIPRTMISNEVYYLPLNDDGSPQVQGEYIYLAPKSNEPFTIRFAIEGTSSICRQGSLWVN
IPEPGVEFRRDQFREFKLVPDFNRTIEISIPVHLPGAYAFYTTYAKLPELEQTAGADSSP
SSTDKNKTQLYYIDVAPRLQLDGRPLPLPALSIFSVISKFMGKYPNDWERHLRGISDRGY
NMIHFTPLQTRGTSNSPYSLYDQLSWDPECFPEGEKDIKKLVDSLEKNHSLLSLTDIVLN
HTADNSEWLLEHPEAGYNLTTAPWLELPFLIDTKLLELGFNLAKLGLPTEVKSEADVLAI
MDAVKKEVISAIRMWEYYVVDVESNAEVAAEAWAAGKGSFPDGSLGTEGPAGLKSASLSE
RAQFVIKYGLSGTDRMGERFRRKVVPEVAAGVLDALLGRPEGHQGPDSGAARQKMIEILQ
AVNVPFYEEYDKDSAEILEQTFNRIKYVRLDEHGPKLGPINEANPLVETYFTRLPRNEKT
AKHKKEDLVLVNNGWVWGGNALVDNAGPDSRVYLRREVIVWGDCVKLRYGAGPEDSPYLW
DRMTKYSRMLAKYFAGFRIDNAHSTPIHVAEHILDEARRVRPDLYVCGELFTGSEEMDYV
FVKRLGLSSLIREAMQAWSTGELSRLVHRHGGRPIGSFEVDEVSRGDASPTSPHPQSPQV
NGGTTDEMWSSREIIRRIKPSPVQALFMDCTHDNEVPAQKRDARDTLPNAALVSMCASAT
GSVMGYDEIYPKLVDLVNETRLYTSESSAREVKVGSGKGGIGGLKKLMNQIHTLMGKDGY
DETHIHHEDQYITVHRVHPQSRKGYFLIAHTAYPGYGNGNGAFNPVHLTGTKVRHLGSWT
LEVDDSEEARKNVLEDKKHLRGLPSRVIDLPGIRMEVKGSDTVITVRDRFPPGSIALFET
YIPAAEHSAGLDTYVTSQAQDAFAGLNLIDMNFMMYRCEAEERDWSGGSDGVYGIPGHGN
LVYAGLQGWWSLLEGIIRDNNLAHPLCQNLREGQWALDFIIGRLERASKTPEFSRLEKPT
RWLKDRFDAIRGIPSFLLPRYFALVMRTAYMACFERSVSLMNENVAKGQWFLKSLAMVST
QETGIVKSASLYPDHLVPSLAAGLPHFAVDWARCWGRDIFISLRGLFLGTGRFDEAREHI
LAFASVLKHGMIPNLLGAGRTPRYNARDSIWFFLQCIQDYTRLVPNGLSLLDEKVKRRFL
PYDDTYFDAEDSRAYSTQSTIRDIIQEALQRHASGMSFREANAGPSLDMQMSDKGFDLEV
KVDWDTGFVLGGNQFNCGTWMDKMGESEKAGSKGVPGTPRDGAAVEITGLMYSTVKWVAK
LHSSGEFPYSGVSKAAVGPDQDPKSVNVDVSYADWAELVKSNFERCYFVPLDPSEDSKYD
VNPSVINRRGIYKDLYRSGKEYEDYQLRPNFPIAMTVAPDLFDEAHAMHALCIADQVLRG
PQGMATLDPADLNYRPYYVNSEDSTDFATSKGRNYHQGPEWLWPTGFFLRALLKFLLKRT
HSAEDGESAATEAFQQVTRRLMGCKAMIKESPWAGLQELTQKDGGFCGDSCPTQAWSASC
LIDLYMDADEEQARMQKGVGVNGSSQKN
NT seq 4767 nt NT seq  +upstreamnt  +downstreamnt
atgataccaaggacaatgatttccaacgaggtgtactacctacctctcaacgacgatggg
tcgccccaagtccagggcgagtacatttacctcgcgcctaagtcgaacgagccgtttacc
atcaggtttgccatagagggcacttcgagcatctgtcgtcaaggcagcttgtgggtaaat
attccggagccaggagtagagtttcgcagagatcagttccgagagttcaagcttgtgccc
gacttcaatcgaacaatcgaaatctcgatacctgtccacctgcctggcgcttatgccttc
tacaccacctacgccaagcttcctgagctcgagcagactgcaggtgccgattcctcacca
tcatcgaccgacaagaacaagacacagctgtactacatcgatgtcgcaccgaggctgcag
ctcgacgggcggccgctgcctctgcccgccttgtcaatcttctcagtcattagcaagttc
atgggcaaataccccaatgactgggagcgtcaccttcgagggattagcgaccgcggttac
aacatgattcatttcacaccgctgcagacacgcggaacttccaattcaccatacagtctg
tacgatcagctcagctgggacccagaatgcttccccgagggtgagaaggacattaagaaa
cttgtcgacagtctggagaagaaccattctctactgagcttgaccgacattgtcttgaat
cacaccgcggacaacagcgaatggctcctggagcatcctgaggctggctacaatttgaca
acggcgccatggcttgagctgccattcctcatcgataccaaacttctcgagcttggcttc
aacctggctaagctcggtctgccgacagaggtcaagtcagaggctgatgttctggccatc
atggatgctgtcaagaaggaggtcatcagcgccatccgcatgtgggagtactatgtcgta
gacgtggaatccaacgcggaagtcgccgcggaagcctgggctgccggaaaaggctccttc
cccgacggctcccttggtactgagggtcctgccggcctcaagtccgccagcttgtcagaa
cgggcacagtttgtcatcaagtatggcctttcaggaactgaccggatgggtgagcggttc
aggcgaaaggtggtaccggaagtagctgctggcgtgctagatgcgctgctcgggcgacct
gagggtcaccaaggtccagactctggtgctgctcggcagaagatgatcgaaattcttcag
gccgtcaatgtacccttctacgaagagtacgacaaggacagtgccgagattcttgagcag
actttcaatcggatcaagtacgtacgtttggacgagcacggcccgaagctgggaccgata
aacgaggcaaacccactagtggagacttacttcacccgtctaccccgaaacgagaagacg
gccaagcacaagaaggaggatctcgtcctcgtcaacaatggctgggtatggggtggaaac
gctctcgttgacaacgcaggaccagattcccgtgtctaccttcgtcgcgaggtcattgtt
tggggcgattgtgttaagctgcgctatggcgctggtcctgaggacagcccatacctttgg
gatcggatgacaaagtactcgcgaatgctcgccaaatactttgctggtttccgtatcgac
aacgcgcattccacgcctatccatgtcgccgagcacatactggatgaggctaggcgagtg
cgccccgacctgtacgtgtgtggtgagctcttcactggaagcgaggaaatggactacgtc
tttgtgaagcgactcgggctgagctcgttgatccgagaagccatgcaggcatggagcact
ggcgaactcagtcgtctcgttcatcgccatggcggtcgcccgattggtagcttcgaggta
gacgaggtttctaggggcgacgcctcgccgacctcgccgcacccccaatcaccccaggtt
aatggtggaacgacggatgaaatgtggtcctcgcgggagatcattcgccgcatcaaaccg
tcgcccgttcaggctctcttcatggattgcactcatgacaacgaggttccagcacagaag
cgcgatgcgagagatactctacccaacgctgcactggtcagcatgtgcgcgagtgccacc
ggtagcgtcatgggctatgacgaaatctatcccaagctcgtagacctggtcaatgagacc
cgcctatacacctccgagtcatctgctcgtgaagttaaggtcggaagcggcaaaggtgga
attggcgggctgaaaaagctcatgaaccaaattcacactctgatgggcaaggatggatat
gatgagacgcatatccaccatgaggatcagtacattacagtccacagggtgcacccccag
tcacggaagggatacttcctcattgcccacactgcctatcccggatatggcaacggcaac
ggtgccttcaatcccgttcatctcacgggaaccaaggtcaggcacctgggtagttggaca
ctcgaggtggacgacagcgaggaagcgaggaagaatgtgttggaagacaagaaacatctt
cgcggacttcccagccgtgtgattgacctgcctggcattcgcatggaagtcaagggcagc
gacacggtcatcaccgttcgtgatcggttcccccctggcagtattgccttgtttgaaacc
tacatccctgccgccgagcactcggccggtctggacacttatgttacttcgcaagcgcag
gatgcctttgccggactgaacctaatcgacatgaactttatgatgtaccgatgcgaggcc
gaagagcgcgactggagcgggggaagcgacggcgtctacggtatacctggtcatggcaac
cttgtatacgccggtctccagggttggtggagtctccttgagggtataatccgcgacaac
aacctcgcccaccccttgtgccagaacctccgcgaaggccagtgggctttggacttcatc
atcggtcgacttgagcgtgcctcaaagacaccagagttctctcgactcgaaaagcctacg
cgatggctgaaggatcgcttcgatgccattcgtggcatcccaagcttcctacttcctcgc
tactttgccctggtcatgcgtacggcgtacatggcctgctttgaacgtagcgtttcgctg
atgaatgagaatgtggccaagggtcagtggtttctcaagagtcttgccatggtcagtaca
caggagacgggtattgtcaaatcggcgtcgctctatcccgaccatctggtcccctcgttg
gctgctggcttgccgcactttgctgtcgattgggcaagatgctggggcagagacattttt
atctcgctgagaggcctgttcctcggcacgggaagattcgatgaggcccgggaacacata
ctcgcctttgcaagtgttctcaagcacggcatgattcccaacctactaggtgctggacgt
acaccccgatacaatgcccgcgattcaatctggttcttcctgcagtgtatccaagactac
actcgcttggtgccaaacggcctttccctgctggacgagaaggtgaagcgtcgtttcctt
ccttatgacgatacatactttgacgctgaagattctcgtgcctactccacacagagcact
atccgggacatcatacaagaggctctgcagcgtcacgcgagtggaatgtctttccgcgaa
gccaatgccggacccagtttggatatgcaaatgagcgataaaggctttgatctcgaggtt
aaagtcgattgggacacgggatttgttctcggtggcaaccagttcaactgcggtacttgg
atggacaagatgggtgagagcgaaaaggctgggtccaagggagttcccggcaccccccgc
gatggcgcagccgtcgagatcacaggtttgatgtacagcacagtcaagtgggtagccaag
ctgcactcatcgggcgagtttccatacagcggtgtgagcaaggctgccgtcggtcccgat
caggaccccaagagtgtcaacgtggacgtgtcgtatgcggactgggccgagcttgtcaag
tccaactttgagcgctgctattttgtcccgctcgatccgtcggaggactcgaagtacgat
gtcaacccatccgtcatcaaccgtcgtggcatctacaaggacctgtaccgatccggcaag
gagtatgaggactaccaactcaggccgaacttccccatcgcgatgacggttgcaccagac
ctgttcgacgaagcccacgccatgcacgcgctctgcattgccgaccaggtgcttcgcggt
cctcagggcatggcaactctggacccggcggaccttaattacagaccttactacgtgaac
agcgaagacagcaccgactttgcaacatcaaagggcaggaactaccatcaaggaccggag
tggttgtggccgacaggattcttcctgcgcgcgctgctcaagttccttctcaaacgcaca
cattcggctgaagatggtgagagcgcggccaccgaggcgttccagcaggtcacaaggcgt
ctgatgggctgcaaggccatgatcaaagagagcccttgggctggtctgcaggagctgaca
cagaaagatggtggattctgtggagattcgtgcccaacacaggcttggtcggctagctgc
ctcattgacctctacatggatgcggacgaagagcaggccaggatgcaaaagggtgtcggc
gttaacgggtcgtcgcaaaagaactag

DBGET integrated database retrieval system