KEGG   Magnaporthe oryzae: MGG_00397Help
Entry
MGG_00397         CDS       T01027                                 

Definition
RNA polymerase II transcription factor B subunit 2
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
mgr  Magnaporthe oryzae
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:mgr03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:mgr03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 490 aa AA seqDB search
MSQQPVITLSDHLEKQNGATFKKLYQQPATAFAIFRRMLPPLAKTFVMSLLYMPQPLPLT
ALDSWVKPEAKKNKDQALSILRSMHITTITPVTKEKPVQEMSLTPNFKKSLRLALEGGGS
HNSFGVPSSLPIPPQVDVAFLDKWARSRWDAILHYVVNSVEETDSMEPSKKYNFGGSKLQ
DTVKTLLVQGGLVQRRSSERISITKTGFTFLLQEANAQVWTLLLQWLHSVNEDNTNRAVD
MLSFLFMLGTLELGQAYDTGALSEERRNMLPDLNDFGLVYIPPSNPDQYFPTRLATTLTS
GSSALRSVSSGVAAATAEAGENNTKGAIILETNFRIYAYTSTPLQIAILALFANLKMRFA
GMVTGQLSRHSIKRAISHGITADQIIEYLASHAHEQMHRIAAIRNKPVLPPTVVDQIRLW
QLETERMQVQRGYLFKDFESQAEFKAIADYADEVGVLIWRSDARQLFFASKTAEIANFIK
SEKHRKKLAA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagcaaccggtcattacgttgtccgatcacctcgaaaagcagaatggcgctacg
tttaagaagctataccagcagccggctacggctttcgccatcttccgccgaatgctacca
ccattagccaaaacatttgtcatgtcgcttctatatatgccgcagccgctaccgcttact
gctctggattcttgggtgaagcccgaagcgaagaagaacaaggaccaggcgctttccatc
ctacgctctatgcacattactaccatcacgccggttaccaaagagaagccggtacaggaa
atgtcgttgacgccaaacttcaaaaagtccctacggttggcccttgagggcggaggctct
cacaactctttcggcgtcccatcaagtcttccgataccaccacaagtcgatgttgcattt
ttggataagtgggcacggtcaagatgggatgccattttacattatgtggtcaacagcgtg
gaagagacggattcaatggaaccaagtaagaagtacaactttgggggctctaaacttcag
gatacggtcaaaactctgctggtgcagggtggccttgtccagcgccgaagttcggagagg
atcagtattacaaaaacaggttttacattcctcctacaagaggcaaacgcccaagtatgg
actttgctcttgcagtggctacacagcgtcaacgaggacaacactaacagggcagtcgac
atgttgagcttcctgtttatgcttggtactcttgagcttggtcaagcctacgatacaggg
gcactctcggaagaacgccgcaatatgctgcctgatttgaacgactttggtctggtatat
atcccgcccagcaacccagatcaatactttcctactcgtctcgccacaacccttacaagc
ggatcttcggcactaaggagtgtcagctccggcgttgcggccgccaccgctgaggcgggc
gagaacaataccaagggggccattattctcgagaccaatttccgcatctatgcatacaca
agcacaccactacagatagcaatcctagcactttttgccaacctcaagatgcgcttcgca
ggcatggttactggacagctgagtcggcactcgatcaagcgtgcaatctcccacggtatc
acagccgaccaaatcatcgaatacctggcatcacatgcgcacgagcaaatgcaccgtatt
gcggcgattcgcaacaagccagtccttccaccaaccgtcgtggatcagatccgtttgtgg
cagctcgagacggagcgcatgcaggtccagagaggctacttgttcaaggattttgagagc
caggccgagttcaaggccatcgcagattacgcggatgaagtaggtgttttgatatggcgc
agtgacgcccggcagctattctttgctagcaaaacggcagagattgccaactttatcaag
tcggagaagcaccgtaagaagcttgctgcctag

DBGET integrated database retrieval system