KEGG   Magnaporthe oryzae: MGG_00397Help
Entry
MGG_00397         CDS       T01027                                 

Definition
RNA polymerase II transcription factor B subunit 2
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
mgr  Magnaporthe oryzae
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    MGG_00397
  Replication and repair
   03420 Nucleotide excision repair
    MGG_00397
Transcription machinery [BR:mgr03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     MGG_00397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 490 aa AA seqDB search
MSQQPVITLSDHLEKQNGATFKKLYQQPATAFAIFRRMLPPLAKTFVMSLLYMPQPLPLT
ALDSWVKPEAKKNKDQALSILRSMHITTITPVTKEKPVQEMSLTPNFKKSLRLALEGGGS
HNSFGVPSSLPIPPQVDVAFLDKWARSRWDAILHYVVNSVEETDSMEPSKKYNFGGSKLQ
DTVKTLLVQGGLVQRRSSERISITKTGFTFLLQEANAQVWTLLLQWLHSVNEDNTNRAVD
MLSFLFMLGTLELGQAYDTGALSEERRNMLPDLNDFGLVYIPPSNPDQYFPTRLATTLTS
GSSALRSVSSGVAAATAEAGENNTKGAIILETNFRIYAYTSTPLQIAILALFANLKMRFA
GMVTGQLSRHSIKRAISHGITADQIIEYLASHAHEQMHRIAAIRNKPVLPPTVVDQIRLW
QLETERMQVQRGYLFKDFESQAEFKAIADYADEVGVLIWRSDARQLFFASKTAEIANFIK
SEKHRKKLAA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagcaaccggtcattacgttgtccgatcacctcgaaaagcagaatggcgctacg
tttaagaagctataccagcagccggctacggctttcgccatcttccgccgaatgctacca
ccattagccaaaacatttgtcatgtcgcttctatatatgccgcagccgctaccgcttact
gctctggattcttgggtgaagcccgaagcgaagaagaacaaggaccaggcgctttccatc
ctacgctctatgcacattactaccatcacgccggttaccaaagagaagccggtacaggaa
atgtcgttgacgccaaacttcaaaaagtccctacggttggcccttgagggcggaggctct
cacaactctttcggcgtcccatcaagtcttccgataccaccacaagtcgatgttgcattt
ttggataagtgggcacggtcaagatgggatgccattttacattatgtggtcaacagcgtg
gaagagacggattcaatggaaccaagtaagaagtacaactttgggggctctaaacttcag
gatacggtcaaaactctgctggtgcagggtggccttgtccagcgccgaagttcggagagg
atcagtattacaaaaacaggttttacattcctcctacaagaggcaaacgcccaagtatgg
actttgctcttgcagtggctacacagcgtcaacgaggacaacactaacagggcagtcgac
atgttgagcttcctgtttatgcttggtactcttgagcttggtcaagcctacgatacaggg
gcactctcggaagaacgccgcaatatgctgcctgatttgaacgactttggtctggtatat
atcccgcccagcaacccagatcaatactttcctactcgtctcgccacaacccttacaagc
ggatcttcggcactaaggagtgtcagctccggcgttgcggccgccaccgctgaggcgggc
gagaacaataccaagggggccattattctcgagaccaatttccgcatctatgcatacaca
agcacaccactacagatagcaatcctagcactttttgccaacctcaagatgcgcttcgca
ggcatggttactggacagctgagtcggcactcgatcaagcgtgcaatctcccacggtatc
acagccgaccaaatcatcgaatacctggcatcacatgcgcacgagcaaatgcaccgtatt
gcggcgattcgcaacaagccagtccttccaccaaccgtcgtggatcagatccgtttgtgg
cagctcgagacggagcgcatgcaggtccagagaggctacttgttcaaggattttgagagc
caggccgagttcaaggccatcgcagattacgcggatgaagtaggtgttttgatatggcgc
agtgacgcccggcagctattctttgctagcaaaacggcagagattgccaactttatcaag
tcggagaagcaccgtaagaagcttgctgcctag

DBGET integrated database retrieval system