KEGG   Magnaporthe oryzae: MGG_00481Help
Entry
MGG_00481         CDS       T01027                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mgr  Magnaporthe oryzae
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MGG_00481
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MGG_00481
Enzymes [BR:mgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MGG_00481
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 444 aa AA seqDB search
MKAPKSLGTVVIKLGTSSIVDETTKKPLLSILTLIVETAVKLREDGHKVVIVSSGAIGVG
LRRMDIAVRPKKHMSKLQALAAIGQCRLMSLWDSLFTQLRQPIAQILLTRNDIADRSRYL
NAQNTVMELLDMGVIPIVNENDTLAVSEIKFGDNDTLSAITAAMVHAEMLFLMTDVDCLY
DKNPRAHPDAKAIEVVEDIGALSADVSSAGSSLGTGGMFTKIVAARLATSAGVTTIIARA
SNPGNILNIVKWIEANPAATSSRISVNDHTDSFMPRNESGIQPPLHTRFLPSTDPIRDRS
FWILHGLKPHGTVYIDQGAYQALLDKAGLLPVGVVDVEGHFAQQEAVRIVVVEKKLSTPT
PDGKYWEGSTNEVGRALVNYSSAEIARIKGHQSTDIKDLLGYADSEYVVHRAQISFFRRE
SRPVSPTMEMEPITRGIGSYEVTH
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctccgaaatcattgggcactgtggtgatcaagctaggcaccagctccatcgtc
gatgagacgacaaaaaaacctctcctctccatcttgaccctaattgttgagacggccgtc
aagttaagggaagatggacacaaagtcgtcatcgtctcgtcgggtgccatcggcgttggg
cttcgccgtatggacatagccgtaaggcccaagaagcacatgtccaagttgcaggctttg
gcagcaataggacaatgccgcctcatgagtctatgggacagtctcttcacacaattgaga
cagccaatcgcacaaattcttctcaccaggaatgatattgcggacaggtccaggtaccta
aatgcccagaatacagtcatggagctccttgacatgggcgttatccccatcgtaaacgag
aacgacactctcgccgtctcggaaatcaagtttggcgacaatgacacactatccgctatt
actgcagctatggttcatgcagaaatgctattcctcatgacggacgtagattgtctatat
gacaagaatccccgagctcacccagatgccaaggctatcgaggtggtagaggatatcgga
gccttatctgctgatgtgtcctctgccggatcgtctttgggtacgggtggcatgtttacc
aagatcgtggcagcaaggcttgccacctctgcaggagtcaccaccatcatcgccagggcg
tcaaatccgggcaatattctcaacattgtgaaatggattgaggcaaacccagctgccaca
tcgtccaggatcagtgtaaatgaccacacagactctttcatgcccaggaacgaatcagga
attcagcctccattacacacacgattccttccctcaacagacccaatcagggaccggtca
ttctggatccttcacggcctcaagccacacggcacagtctacatagaccaaggcgcgtac
caagcactgttggataaggctggcctactacctgtgggtgtagtggatgtcgaaggacac
tttgcacagcaggaagccgtccggatcgtggtggtcgagaagaaactctcaacgccaacc
cctgacggaaagtactgggagggttctaccaacgaggttggccgagctttggtgaactac
tcatcggccgagatcgccaggatcaagggtcaccaaagcacagatatcaaggatctactc
ggctacgctgacagcgagtacgtcgttcaccgagcgcagatcagcttcttcaggagggaa
agcagaccggtctccccaacaatggagatggaacccatcacccgcggaattggaagctac
gaggtcacacactaa

DBGET integrated database retrieval system