KEGG   Magnaporthe oryzae: MGG_00481Help
Entry
MGG_00481         CDS       T01027                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mgr  Magnaporthe oryzae
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mgr01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mgr00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 444 aa AA seqDB search
MKAPKSLGTVVIKLGTSSIVDETTKKPLLSILTLIVETAVKLREDGHKVVIVSSGAIGVG
LRRMDIAVRPKKHMSKLQALAAIGQCRLMSLWDSLFTQLRQPIAQILLTRNDIADRSRYL
NAQNTVMELLDMGVIPIVNENDTLAVSEIKFGDNDTLSAITAAMVHAEMLFLMTDVDCLY
DKNPRAHPDAKAIEVVEDIGALSADVSSAGSSLGTGGMFTKIVAARLATSAGVTTIIARA
SNPGNILNIVKWIEANPAATSSRISVNDHTDSFMPRNESGIQPPLHTRFLPSTDPIRDRS
FWILHGLKPHGTVYIDQGAYQALLDKAGLLPVGVVDVEGHFAQQEAVRIVVVEKKLSTPT
PDGKYWEGSTNEVGRALVNYSSAEIARIKGHQSTDIKDLLGYADSEYVVHRAQISFFRRE
SRPVSPTMEMEPITRGIGSYEVTH
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctccgaaatcattgggcactgtggtgatcaagctaggcaccagctccatcgtc
gatgagacgacaaaaaaacctctcctctccatcttgaccctaattgttgagacggccgtc
aagttaagggaagatggacacaaagtcgtcatcgtctcgtcgggtgccatcggcgttggg
cttcgccgtatggacatagccgtaaggcccaagaagcacatgtccaagttgcaggctttg
gcagcaataggacaatgccgcctcatgagtctatgggacagtctcttcacacaattgaga
cagccaatcgcacaaattcttctcaccaggaatgatattgcggacaggtccaggtaccta
aatgcccagaatacagtcatggagctccttgacatgggcgttatccccatcgtaaacgag
aacgacactctcgccgtctcggaaatcaagtttggcgacaatgacacactatccgctatt
actgcagctatggttcatgcagaaatgctattcctcatgacggacgtagattgtctatat
gacaagaatccccgagctcacccagatgccaaggctatcgaggtggtagaggatatcgga
gccttatctgctgatgtgtcctctgccggatcgtctttgggtacgggtggcatgtttacc
aagatcgtggcagcaaggcttgccacctctgcaggagtcaccaccatcatcgccagggcg
tcaaatccgggcaatattctcaacattgtgaaatggattgaggcaaacccagctgccaca
tcgtccaggatcagtgtaaatgaccacacagactctttcatgcccaggaacgaatcagga
attcagcctccattacacacacgattccttccctcaacagacccaatcagggaccggtca
ttctggatccttcacggcctcaagccacacggcacagtctacatagaccaaggcgcgtac
caagcactgttggataaggctggcctactacctgtgggtgtagtggatgtcgaaggacac
tttgcacagcaggaagccgtccggatcgtggtggtcgagaagaaactctcaacgccaacc
cctgacggaaagtactgggagggttctaccaacgaggttggccgagctttggtgaactac
tcatcggccgagatcgccaggatcaagggtcaccaaagcacagatatcaaggatctactc
ggctacgctgacagcgagtacgtcgttcaccgagcgcagatcagcttcttcaggagggaa
agcagaccggtctccccaacaatggagatggaacccatcacccgcggaattggaagctac
gaggtcacacactaa

DBGET integrated database retrieval system