KEGG   Magnaporthe oryzae: MGG_00618Help
Entry
MGG_00618         CDS       T01027                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
mgr  Magnaporthe oryzae
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MGG_00618
   00500 Starch and sucrose metabolism
    MGG_00618
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     MGG_00618
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 325 aa AA seqDB search
MVSLTLAILSLAAGALGASRTSAPSGCITVKSGASIQQAVNSLSTTASGTQCIFLERGTY
REQVLVPARKAQLTIYGYSTDTLSHNANGALITQRKSQKDGLSNDETATLRVKAANFRLY
NVNVDNAYGEGSQAVALSAYADSGYYGCRFTGFQDTVLANQGKQLYARCLVQGATDFVFG
QYAAAWFEKNDVRVLGKSLGYITANGRLDNSNPSYYVFNNCNVAAASGQSVPRGAYYLGR
PWREFARVVFQNTAMTEVINSAGWKTWNTGDERISNVLFGEYANSGAGSQGQRASFSKKL
GSAVGIDSILGSGHRSAAFYDGSYM
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggtgtccctcaccctagccatcctgtccctcgcggcgggagccctgggcgcatccagg
accagcgcgccctcgggctgcatcacggtcaagtcgggcgccagcatccagcaggcggtc
aactcgctgtcgacgaccgcctccggcacccagtgcatcttcctggagcgcggcacgtac
cgggagcaggtgctcgtgcccgcgcgcaaggcccagctgaccatctacggctactcgacc
gacacgctgagccacaacgccaacggcgcgctcatcacgcagcgcaagtcgcaaaaggac
ggcctgtccaacgacgagacggccacgctgcgcgtcaaggcggccaactttaggctctac
aacgtcaacgtcgacaacgcctacggcgagggcagccaggccgtcgccctgagcgcctac
gccgacagcggctactacggctgccgcttcaccggcttccaggacaccgtgctggccaac
cagggcaagcagctgtacgcgaggtgcctggtccagggcgccaccgactttgtctttggg
cagtacgccgccgcgtggttcgagaagaacgacgttagggttctgggcaagtctcttggg
tacattactgcaaacggccgtctcgacaacagcaacccgtcctactacgtcttcaacaac
tgcaacgtcgccgctgcgtcgggccaaagcgttccccggggtgcctactacctcggccgg
ccgtggcgcgagtttgcacgcgtcgtgttccaaaataccgccatgaccgaggtcatcaac
tcggcgggatggaagacgtggaacacgggcgacgagcgcatcagcaacgtcctgtttggc
gagtacgctaactcgggcgccgggtcgcagggtcagcgcgcgtctttttccaagaagctg
gggtcggccgtcggcatcgactcgattctgggcagcggccaccgcagcgcagccttctat
gacggttcttatatgtaa

DBGET integrated database retrieval system