KEGG   Magnaporthe oryzae: MGG_00621Help
Entry
MGG_00621         CDS       T01027                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mgr  Magnaporthe oryzae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MGG_00621
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    MGG_00621
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MGG_00621
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 948 aa AA seqDB search
MASNDDSLDALWQDLDWAIGQMLIMGWDGTEVTPQIRNLIETHHLGSILLTAKNLKSAHE
TAKLVQELQTIARQAGHPYPLLIALDQENGGVNSLFDEDYICQFPSAMGVAAAGNPELAY
NVAKATATEVSAVGVNLILGPVLDVLTNARYQPLGVRATSDDPQEVSQYGIAAMNGYKAA
GVATCGKHFPSYGNLDFLGSSLDIPIITQTLEELSLSALVPFRNAIATGSLDGMFVGGCG
IANPSMNVMHACLSDQVVDDLLRNDLGFTGVAISECLEMEALSHEIGVKGGTVMAVEAGC
DLVLLCRAYDVQLEAIAGMKLGIENGIITRERIYTSLQRVLRMKRGCTSWSKALNPPGIS
LLSKIHPSHLALSKQAYDSSITVMRDKDKLLPLNGSMHQDDELLLLTPLVKPLPASAATK
TLLRSKDTYEQASGVHDKWSHRERGALMSGEGVFREFGRSLARARHGKLLHTSYTANGVR
PVHENLIDKASCIIIVTADANRNLYQAGFTKHVATICAMLRAGGQKKSLIVVAVSSPYDF
AMDKTIGTYICTFDFTETAMHALVRVLVGEFTPHGTLPGTLRKSKKVLQSRQQWLVESYE
RERDAHGLDDLIQSVARSMPGGALPGSASNHIAAATAATFELSNPRVDEAHFVVRNSSTK
ALYGFCATYCIEGVGIIGSIFVDPSKRNVSVGRSLHRRALRSLMHRGGGCNKLQLGTSFP
GVFLGVPIADSPPSASMAEQGATSAKAWFTSSGWDVQFPRLLTSLAIADLPSWGAPEGLL
QSIQRANISFDLIHGLSESGETVLAHVRAHANPEVQELYRAALEETKTCGVVRAKGNNDT
LLGTVVISSPGSNLSTHLPAFGNLHGEDTTIGGIIAPVLAPSGSHSGVLVLQGLALMGLR
QNKAHKSSRSVLSWVYDDAFEPLVAMGFEIAQQFEEITNSLDNWPDLV
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaacgacgatagcctggatgcactatggcaggatctcgattgggccataggg
cagatgttgattatgggctgggatggcaccgaagtgactccccagatacgcaacctgata
gagactcatcatctgggctccatcctactcactgcaaagaatctcaaatcggcgcatgaa
actgcgaaacttgtacaggagttgcagaccatcgcccgccaggctggacacccctacccg
cttctcattgcgctagaccaggaaaatggcggagtcaacagtctttttgacgaagactat
atatgccagttcccaagtgcgatgggagtcgccgcggcaggcaacccggagttggcctac
aacgtagcgaaagctacagccaccgaggtttctgctgtgggcgtgaatctgatcctgggc
cctgtcctcgacgttctcaccaatgctagataccagccgctgggcgtgagagccacaagc
gatgacccgcaagaggtatctcaatatggcatcgcggccatgaacggatacaaagcggca
ggggttgccacgtgcggcaaacactttccttcatacggaaatctagactttctcgggtcc
agtctcgatatacccatcatcacgcagacattggaggagttgagtctcagcgccctggtt
cctttcagaaatgcaattgccaccggcagcctcgatggcatgtttgttggtggatgcgga
atcgccaatccatcaatgaatgtaatgcatgcctgcctatcggaccaggttgttgacgac
ttgttgagaaatgaccttggtttcacaggggtcgcaatctcggaatgtctggaaatggag
gctttgagccacgaaattggcgtcaaaggaggaactgtcatggcggttgaggccggctgt
gaccttgtgctcttgtgccgtgcatacgacgtccagctggaggctattgccggtatgaag
ctcggcatcgagaacggcatcattacacgcgagaggatctacacttcgctccaaagggtg
ctacgcatgaaaagaggttgcacgtcgtggtccaaggcattaaacccgccggggatatca
ctcttgtccaagatccatccttctcacctggctctctccaaacaagcatatgacagttcc
atcacagtcatgagggacaaggacaagcttcttcccctgaacgggtcaatgcaccaagat
gatgagctgctactgcttactccgttggtcaagccgctgcctgcatctgcagccaccaag
acacttctcaggtccaaggatacatacgagcaggcctcgggtgtccatgacaaatggtcg
catcgtgaaaggggcgctctaatgagcggcgagggtgttttccgggagttcggcaggtct
ctagcccgggctcgccacggaaagctactacacacttcgtacacagcaaacggagtgaga
ccagttcacgagaatctcatcgacaaggcatcgtgcatcataattgtcacggccgatgcg
aatcgcaacctataccaggctggcttcacaaagcacgtcgcgacaatatgtgcgatgctg
cgagccggtggtcagaagaagtcgctgattgtcgtagcagtcagctcaccttacgatttt
gccatggataagacgataggaacatatatttgcacctttgactttacagagactgcaatg
catgctctggtcagagtcctggtaggcgagttcacgcctcatgggacgcttccaggaacc
ctccgaaaaagcaagaaagtgctccagtcgcgacagcaatggttggttgagagttacgag
cgagaacgcgacgcacatgggctagatgatcttattcagtctgtggcgcgatcaatgccc
ggcggagcccttccaggcagcgcctcaaaccatatagcggcagctactgcagctactttt
gagctttcaaacccgcgtgtcgatgaggcccatttcgtggtaagaaacagcagcaccaag
gccctctacggcttttgcgcaacatactgtatcgaaggggttggtattattggctccatc
tttgtcgacccatcaaaacgcaacgtatcagtcggccggtcgctgcaccggagagctttg
cgcagtcttatgcaccgcggaggtggttgcaacaagctccagttaggaacttcgttccct
ggcgtcttcctgggtgtgcctatagccgattctccgccgtcagcttctatggcagagcaa
ggagctaccagtgccaaagcctggtttacaagcagtgggtgggacgtccagttccccagg
ctactgacaagcctggcaattgccgatctaccatcctggggtgcacctgagggcctgtta
caaagcatccaacgtgctaacatcagctttgatctgatccacggcctctcggagagtggc
gaaactgtgctggctcatgtcagggcgcatgcgaatcctgaggttcaggagttgtatcga
gccgcgttggaggaaaccaaaacgtgtggcgtggtgcgcgccaaaggcaacaacgatacc
ttactgggcacggtggtcatctcaagccctgggagcaacctttctacacacctcccagcc
tttggcaaccttcatggcgaggatacgacaatcggtgggatcatcgcgccagttttggca
ccatcgggctcgcactcgggcgtgttagttttgcagggcctagccctcatggggttgcgg
cagaacaaagcacacaaatcatcgcgcagtgtgttgagttgggtatacgatgatgcgttt
gagccgctcgtggcaatggggtttgaaatcgcgcagcagtttgaggaaatcacaaactca
ctcgacaactggcctgacttggtatag

DBGET integrated database retrieval system