KEGG   Magnaporthe oryzae: MGG_00877Help
Entry
MGG_00877         CDS       T01027                                 

Definition
hypothetical protein
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
mgr  Magnaporthe oryzae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 1275 aa AA seqDB search
MNPPIQSGTVTAAATPFKIPGRLAHKWVEDFLEYGLADEPSFRIGCPAVGKSHHFEAKLD
QCVATDLRNAGKHYIIIVSAICVLCRHHFIFRVTAPTGQLCGQSHGNPQKPLHHLIATTP
ISEDFEPCSLDRGRNPKYLTCGGHSAYKCSTPSCSYRVNIEISEPRVTPEHAHTLLDDAA
VKLRLQNEIQETPERFSGTSDENRAIDYLSQYLTDTLTSPQSRRGSKIKTRNVKFAVQFG
DGESANRLFEFLEFKKGVDNEECAYWELPEMDVPEHAPTSVPSQKSFYQDVRAEIWCLKG
VYKWPGHDSSMGFDRILQDAFHCSHKDAAGLEFQDSFAGAETAKSHFNLLGLTSRSHWKI
FRYAYECQTRVDKLPAHREQYLNALQRISAQYNQDELNFFIATEHSRIDAEHFDQYPSVN
QPESVLSNGIKSIDSADSGYVSIDAIIGEYRNKVQNSHMSPTKETGARKRLDLRSELLKV
ATTHPEGPKLKEVVREPMDLDEALICLDLQVDTDQLKSMDVTVPEAMAQVQVEQGKDAFL
TGMALQAIGKTLNNDVLVALAATMMGEQPQNKVEEEPVNDPNLPAGLDNLRNTCYLNSML
QYFFTINPVRDLILNFDEYKLPENEESRSSRRVTTEERGISAKQAYVANELANELRSLFS
DLISTQNHYATPTQRLALAAMKNTDQLEARARELEARPSETGAQTIGPLPDPNNTKGRTP
DNGMVYAGKAPDYAAPAPPVRANGGRSPGGVTPERTETSSDVSSHTLVNVGPSDYDNDRE
VSSEWNPLIQRVNSVISNASSDNSMRCEVNDDDLMEQQIDSKIGEFNPVGSGKDVEMFDA
SPSQVVSESAAVQAAATALAGLSSHSVSTEPEDEISRIKRALDDKTIKGTDQEDVQEAMD
KMLFNLRSAIKPTGTEPLGPKAEAQTDAVTEILRLIKVEYQKPLNKAKWELTTPTTEDFL
LAYPARSDSVELHEAIERGFMRQISENPKEPDNPFLSFSSIRRFPPILHICIQRTVYDQS
ARAGKKIDVSIQLPQVLYMDRYKESAPGDALWMRRHKYWDHLELEDPKVLAARRKLEQKK
PGTADADTAMAEAQDAAVDELEAYHNEAVNQANGTDSNHNQPSDIDLGDEADSEAEAEAK
RQKYEDTFDDLRDHEYHLHAVICHGGSTGASGHYWVWIFDFEQRVWYNYNDRTVRVHKDN
EKVLKDLSASDQPYYIAYVRRDNLDLVSIPRRANREQEKQPEMCERPMSPPPTPPRRPAS
MAATGISGFDVEMTP
NT seq 3828 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctccgatccagtccggaacggtgacagctgcggccaccccgttcaagattccc
ggacgtctcgctcacaaatgggtcgaggatttcttggaatatggccttgccgacgaacct
agcttccgcatagggtgccctgctgttggcaaatctcaccatttcgaagcaaaactggac
cagtgtgtagcaacggatctacgcaatgctgggaagcattacattataatagtgtccgcc
atctgtgtactatgtcggcatcacttcattttcagggtcacagctccgacgggtcagcta
tgtggacagtctcacggtaacccgcagaagccccttcatcacctgatagctacgacccct
atcagtgaagattttgagccctgcagtctggacagaggtcgcaatccaaagtatctcacc
tgcggtggccactcggcatataagtgctcgaccccgagctgctcctatcgcgttaacatc
gaaatttcggagcctcgggtcacgcccgagcatgcgcacaccctcttagacgacgctgct
gtcaagttacgacttcagaacgaaatacaggagaccccggagaggttcagcggcacaagc
gacgagaatagagctatcgattacttgtctcaatatcttacggataccctaacttctcca
cagagccgtagaggctccaaaatcaagacccgcaatgtcaagtttgcggttcagtttggc
gacggcgagagtgcgaataggctttttgagtttcttgaattcaagaaaggcgtcgacaac
gaggaatgcgcctattgggaactacctgagatggatgtccccgaacacgcgcccacttca
gtgccatcgcaaaagtccttctatcaggatgtcagagccgagatttggtgtctcaaaggg
gtgtacaagtggccaggccatgactccagcatgggcttcgacagaatactacaggatgca
tttcactgcagccacaaagacgccgctggcctcgagtttcaagacagttttgctggcgca
gagactgccaaatcccacttcaacttgcttggcttgacaagccgatctcactggaagatc
ttccgctatgcctatgagtgtcagaccagagtcgacaaattacctgcccatcgcgaacaa
tatctcaatgctcttcaaaggatatctgcgcaatataatcaggatgagctcaacttcttc
atcgctaccgaacattcgcgaatcgacgccgagcactttgatcagtaccccagcgtcaat
cagccagagagcgtactgtcgaatggtatcaagagtattgattcggccgattctggctat
gtatcaatcgatgccatcatcggcgagtataggaataaggttcagaactcgcacatgtct
cccaccaaagagacaggagcacgcaaacggcttgacctgcgatctgagttgcttaaggtt
gcaaccacccatcctgaaggaccgaagcttaaggaggtcgtccgagaaccgatggatttg
gacgaggcactcatctgtctggatttgcaagtcgacacagaccagctgaagtccatggat
gttacagtgcctgaagcgatggcccaagttcaggtagagcagggcaaagatgcattcttg
acgggaatggcactccaagcaattggcaaaacactcaacaacgatgtgcttgtcgcactg
gcagcgacgatgatgggagaacagccacaaaacaaggttgaggaggaacctgtcaatgac
ccaaacctaccagctggactggataatctgcggaacacgtgctatctcaacagcatgctg
cagtacttcttcactatcaatccagtccgagaccttatcttgaactttgacgagtacaag
ctgcctgagaatgaagaaagccgaagctcacgacgcgtgactacggaagaacgtgggatc
agtgccaaacaggcctacgttgccaacgaacttgccaatgaacttcgaagtcttttttcg
gacctcatcagcacgcaaaaccattatgctacgcccacccagaggcttgcactagctgcc
atgaaaaatacggaccaacttgaagcgcgggcgagagagcttgaggcccgcccaagtgaa
acaggagcccagaccattgggcccttaccagatcccaataatactaagggccgaacaccg
gataacggcatggtttacgcgggaaaggcccccgactatgcagcaccagcgcctccagtt
cgtgccaatggaggcagaagtcctggtggggtcactccagagcgtaccgagacttctagt
gacgtcagctcgcacactctggttaatgttggtcccagtgactatgataatgatcgggag
gtcagctccgaatggaaccctctgattcaacgtgtcaatagtgtgatatccaacgcgtct
tcggacaacagcatgcgttgcgaggtcaacgacgatgacttgatggaacagcaaatcgac
agtaagattggagagttcaacccagttggctctggaaaagatgtcgaaatgttcgatgcc
tcaccttcccaagtggtctcggagagcgcggcagtgcaagcagcagcaactgctttagct
ggtctatccagccattctgtcagtaccgagcctgaggatgagatttcacgcatcaaaagg
gccctagatgacaagactatcaagggcaccgatcaagaagatgttcaagaagcgatggac
aagatgctgtttaacctgcgaagtgccataaaaccaactggtacagaacccctgggtcct
aaggcggaagcacagacagatgcggtgaccgagatattgcgtcttatcaaagtggaatac
cagaaacccctcaacaaggccaaatgggaactcacgacacctacgacagaggacttcttg
ttggcctatcctgcaagatccgacagtgttgaactgcacgaggcgattgagagaggattc
atgcggcaaatcagtgagaacccaaaggaaccagacaatccattcttgtctttcagcagt
attcgaaggttccctccgatccttcacatttgcattcagaggacagtctacgaccagtcg
gctagggccggcaaaaagatcgatgtctcaatccaactaccccaggtgttatacatggac
cggtacaaagaatcagcacctggagatgcactctggatgagacggcacaaatactgggac
catctcgagctcgaggaccctaaggttctagctgcaaggagaaagttggagcagaagaag
cccggaactgccgatgccgatactgccatggccgaagcccaggatgctgccgtggacgaa
ctggaggcgtatcacaacgaagcagtgaaccaggcaaacggtaccgactcaaaccacaac
caaccgagtgacattgacctaggggatgaagcagactcggaggctgaggccgaggcgaag
cgccaaaagtacgaagacacatttgatgacctccgagaccacgaataccacctgcatgca
gtgatctgccacggcggtagcacaggtgcttcgggtcattactgggtttggatattcgac
tttgagcagcgggtctggtacaactacaacgacaggacggtgcgcgtacataaagacaac
gaaaaagtcctcaaggacctctcagcctctgatcagccatactacattgcctacgtgcgt
agggacaatctcgacctcgtatcgatccctcgtcgcgccaacagggagcaggagaaacaa
cccgagatgtgcgaaagacccatgtcaccgccaccaactcctccgcggcggcctgcttca
atggcagccactggaatcagtggtttcgatgtcgagatgacgccttga

DBGET integrated database retrieval system