KEGG   Magnaporthe oryzae: MGG_00901Help
Entry
MGG_00901         CDS       T01027                                 

Definition
2,3-bisphosphoglycerate-independent phosphoglycerate mutase
Orthology
K15633  
2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
mgr  Magnaporthe oryzae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:mgr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mgr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mgr00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:mgr00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mgr00260]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 520 aa AA seqDB search
MSKVEHNACLIVIDGWGVASEESPKNGDAIAAAETPVMDEFARSKTGYVELEASSLAVGL
PEGLMGNSEVGHLNIGAGRVVWQDVVRIDQSIKTGEFSKNEVITQVIEAAKSGNGRLHLC
GLVSHGGVHSKQEHLYSLLKAAKEAQVPKVFIHFFGDGRDTDPKSGVGYMEELLEKTKEI
GIGQIATVVGRYYAMDRDKRWERVELAMKGLVLGEGEASEDPVKTVKERYEKGENDEFLK
PIVVGGDEGRIKDGDNVFFFNYRSDRVRQITQLLGDVDRSPRPDFPYPKIKLATMTRYKL
DYPFDVAFEPQKMGNVLAEWLGKQNVPQVHVAETEKYAHVTFFFNGGVEKAFALEERDES
QDLVPSNKSVATYDKAPEMSADGVADQVAKRLGEQKFPFVMNNFAPPDMVGHTGVYEAAI
VGCAATDKAIGKIYEACKAHNYVLFITADHGNAEEMKFPDGKPKTSHTTNKVPFIMANAP
EGWSLKPVGGVLGDVAPTVLACMGLPQPEEMTGENLLVKA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggtggagcataatgcctgtctgatcgtgattgatgggtggggggtggcgtcg
gaggagtcccccaagaacggcgatgccatcgcggcggccgagacccccgtcatggacgag
ttcgctcgcagcaagaccggctacgttgagcttgaggcctcgtcgctggctgtcggcctg
cccgagggattgatgggtaactccgaggtcggacatctcaacatcggtgccggcagggtt
gtctggcaggacgtcgtacgcattgaccagtcgatcaagactggcgagttcagcaagaac
gaagtcattactcaggttattgaggctgccaagagcggaaacggccgtctccacctttgc
ggtctcgtctcccatggaggtgttcactccaaacaagagcacctgtactcactcctcaag
gctgccaaggaggcacaagtccccaaagttttcatccactttttcggagatggcagagac
actgatcccaaatctggtgttggttacatggaggagctgctcgagaaaaccaaggaaatt
ggcattggccagattgcaacagtcgttggcaggtactatgccatggacagggacaagagg
tgggagagagtcgagcttgccatgaagggtctggtccttggtgagggtgaggccagtgag
gaccctgtcaagacggttaaggaacgatacgagaagggcgagaacgatgagttcctgaag
cccattgttgttggaggcgatgagggacgcatcaaggatggtgacaatgtcttcttcttc
aactaccggtctgatcgggtgcgtcagattacgcagctgctgggcgatgttgataggtcc
cctaggcccgatttcccctaccccaaaatcaagcttgctacaatgacccgttacaagctc
gactaccccttcgatgttgcctttgagccacagaagatgggcaacgtgttggctgagtgg
cttggaaagcagaacgtgcctcaggtgcacgttgctgagacagagaaatatgctcacgtc
acgtttttcttcaacggtggtgttgagaaggcctttgcccttgaggagcgtgacgagagc
caggatcttgtcccatccaacaagagtgtggctacgtacgacaaggcacccgagatgtcg
gccgacggcgtcgccgaccaggtggccaagcgtcttggtgagcagaagttcccgttcgtc
atgaacaactttgcgcctcccgacatggtcggtcatactggtgtgtatgaagctgccatt
gttggctgcgcggcgacggacaaggctattgggaagatttatgaggcatgcaaggcgcac
aattacgtcctcttcatcacggcggaccacggcaacgccgaagagatgaagttccccgac
ggaaagcccaagacctcccacacgaccaacaaggttcccttcatcatggccaatgcgccc
gagggttggagtctcaagcccgtgggtggcgtgctaggcgatgtagcgccaactgtcctg
gcttgcatgggtctgccccagcctgaggagatgacaggtgagaatttgctggtcaaggca
taa

DBGET integrated database retrieval system