KEGG   Magnaporthe oryzae: MGG_00901Help
Entry
MGG_00901         CDS       T01027                                 

Definition
2,3-bisphosphoglycerate-independent phosphoglycerate mutase
Orthology
K15633  
2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
mgr  Magnaporthe oryzae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MGG_00901
   01230 Biosynthesis of amino acids
    MGG_00901
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGG_00901
  Energy metabolism
   00680 Methane metabolism
    MGG_00901
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MGG_00901
Enzymes [BR:mgr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     MGG_00901
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 520 aa AA seqDB search
MSKVEHNACLIVIDGWGVASEESPKNGDAIAAAETPVMDEFARSKTGYVELEASSLAVGL
PEGLMGNSEVGHLNIGAGRVVWQDVVRIDQSIKTGEFSKNEVITQVIEAAKSGNGRLHLC
GLVSHGGVHSKQEHLYSLLKAAKEAQVPKVFIHFFGDGRDTDPKSGVGYMEELLEKTKEI
GIGQIATVVGRYYAMDRDKRWERVELAMKGLVLGEGEASEDPVKTVKERYEKGENDEFLK
PIVVGGDEGRIKDGDNVFFFNYRSDRVRQITQLLGDVDRSPRPDFPYPKIKLATMTRYKL
DYPFDVAFEPQKMGNVLAEWLGKQNVPQVHVAETEKYAHVTFFFNGGVEKAFALEERDES
QDLVPSNKSVATYDKAPEMSADGVADQVAKRLGEQKFPFVMNNFAPPDMVGHTGVYEAAI
VGCAATDKAIGKIYEACKAHNYVLFITADHGNAEEMKFPDGKPKTSHTTNKVPFIMANAP
EGWSLKPVGGVLGDVAPTVLACMGLPQPEEMTGENLLVKA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggtggagcataatgcctgtctgatcgtgattgatgggtggggggtggcgtcg
gaggagtcccccaagaacggcgatgccatcgcggcggccgagacccccgtcatggacgag
ttcgctcgcagcaagaccggctacgttgagcttgaggcctcgtcgctggctgtcggcctg
cccgagggattgatgggtaactccgaggtcggacatctcaacatcggtgccggcagggtt
gtctggcaggacgtcgtacgcattgaccagtcgatcaagactggcgagttcagcaagaac
gaagtcattactcaggttattgaggctgccaagagcggaaacggccgtctccacctttgc
ggtctcgtctcccatggaggtgttcactccaaacaagagcacctgtactcactcctcaag
gctgccaaggaggcacaagtccccaaagttttcatccactttttcggagatggcagagac
actgatcccaaatctggtgttggttacatggaggagctgctcgagaaaaccaaggaaatt
ggcattggccagattgcaacagtcgttggcaggtactatgccatggacagggacaagagg
tgggagagagtcgagcttgccatgaagggtctggtccttggtgagggtgaggccagtgag
gaccctgtcaagacggttaaggaacgatacgagaagggcgagaacgatgagttcctgaag
cccattgttgttggaggcgatgagggacgcatcaaggatggtgacaatgtcttcttcttc
aactaccggtctgatcgggtgcgtcagattacgcagctgctgggcgatgttgataggtcc
cctaggcccgatttcccctaccccaaaatcaagcttgctacaatgacccgttacaagctc
gactaccccttcgatgttgcctttgagccacagaagatgggcaacgtgttggctgagtgg
cttggaaagcagaacgtgcctcaggtgcacgttgctgagacagagaaatatgctcacgtc
acgtttttcttcaacggtggtgttgagaaggcctttgcccttgaggagcgtgacgagagc
caggatcttgtcccatccaacaagagtgtggctacgtacgacaaggcacccgagatgtcg
gccgacggcgtcgccgaccaggtggccaagcgtcttggtgagcagaagttcccgttcgtc
atgaacaactttgcgcctcccgacatggtcggtcatactggtgtgtatgaagctgccatt
gttggctgcgcggcgacggacaaggctattgggaagatttatgaggcatgcaaggcgcac
aattacgtcctcttcatcacggcggaccacggcaacgccgaagagatgaagttccccgac
ggaaagcccaagacctcccacacgaccaacaaggttcccttcatcatggccaatgcgccc
gagggttggagtctcaagcccgtgggtggcgtgctaggcgatgtagcgccaactgtcctg
gcttgcatgggtctgccccagcctgaggagatgacaggtgagaatttgctggtcaaggca
taa

DBGET integrated database retrieval system