KEGG   Magnaporthe oryzae: MGG_00946Help
Entry
MGG_00946         CDS       T01027                                 

Definition
Poly(A)+ RNA export protein
Orthology
K14298  
mRNA export factor
Organism
mgr  Magnaporthe oryzae
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:mgr03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 358 aa AA seqDB search
MSGLFGGGAAAAQPNTVGDLKNDVAIANPPEDSISDLAFNPNQADQKDFLAVSSWDKKVR
IYEVLGNGTAEGKHAYEHDGPVFSVDYYKDGTKIVSGGADKQAKVCDMNTGQTAQVAQHE
KPVRSVRWFDNNGSPMVITGSWDKTVKYWDLRQQSPVATLQCQERVYTMDVRDKLLVIGT
ADRYINVVNLNEPQKFYKTLQSPLKWQTRVVSCFTDANGFAIGSIEGRCAIQYVEDKDSS
SNFSFKCHRDAPQGSVTSVHAVNDISFHPVHGTFSTAGSDGTFHFWDKDAKHRLKGYPNV
GGSITATTFNKNGNIFAYAVSYDWAKGYQGNNSTYPNKVMLHPVQQDECKPRPSVKKR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcctatttggcggcggcgcggcggccgcgcagcccaacacggtcggcgacctc
aagaacgacgtggcgatcgcgaacccgcccgaagacagcatctcagatctcgcattcaac
ccgaaccaagcagaccaaaaggactttctcgcagtgtcaagttgggacaagaaggtgcgc
atctacgaggtactgggcaacgggaccgcggaggggaagcacgcctacgagcatgatggt
ccggtgtttagcgttgattactacaaggacggcaccaagattgtgtcgggcggcgcagac
aagcaggccaaggtctgcgacatgaacacgggccagacggcgcaggttgcgcagcacgaa
aaaccggtgcgctcagtgcggtggtttgacaacaatggcagcccgatggtgatcacgggt
tcgtgggacaagacggtcaagtactgggacctcaggcagcagtcgcccgtagcgacgctg
cagtgccaggagcgcgtctacaccatggacgttcgcgacaagctgctcgtcatcggcacg
gcggaccgctacatcaacgtagtcaacttgaacgagccgcagaagttctataagacgctg
caaagtccacttaaatggcagacgcgtgtagtgagctgcttcaccgacgccaacggtttt
gctattggcagtatcgagggccgttgcgccatccaatatgtggaggataaggactccagc
tccaacttctcgttcaagtgccatcgagatgctccacagggcagcgtgactagcgtccac
gccgtcaacgacatctcgttccacccggtacacggcacctttagcacggccggttccgat
ggcacgttccacttctgggacaaggacgcaaagcaccgtctcaagggttacccgaatgtc
ggcggcagcatcaccgcgacgaccttcaacaagaacggcaacatctttgcctacgccgtt
agctacgactgggccaagggctaccagggcaacaacagcacgtatcccaacaaggtcatg
ctccatcccgttcagcaggacgagtgcaagccgcgcccgtctgtgaagaagcgatga

DBGET integrated database retrieval system