KEGG   Magnaporthe oryzae: MGG_00969Help
Entry
MGG_00969         CDS       T01027                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mgr  Magnaporthe oryzae
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MGG_00969
Enzymes [BR:mgr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     MGG_00969
Peptidases [BR:mgr01002]
 Cysteine Peptidases
  Family C44
   MGG_00969
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 583 aa AA seqDB search
MCGIFACHAHPDVQKFKPTALRLAKAIRHRGPDWSGSVTCNQTILCHERLSIVGVESGAQ
PLTNEDESIILAVNGEIYNHRLVRKSLKTPYHFKTTSDCEVIIPLYMEHGLDAPKYLDGM
FSFVLYDKKQNRTIAARDPIGVTTFYQGWSSSEPGAVYFGSELKCLYQVCDKIEAFPPGH
IYDSLTGERTRYFQPTWWDPKRVPETPLDLTKLREALEKSVRKRLMAEVPYGVLLSGGLD
SSLVASIAQRETKRLKKLAIEAGLEDLPAEPTGNHDQGEGLVGIDDENKLSTMTYLPQLN
SFSIGLPGSPDNKAALEVAKFLGTKHHVMTFTIEDGLNALSDVIYHLESYDVTTIRASTP
MYLLSRKIKAMGIKMVLSGEGSDEAFGGYLYFHNAPDKDAFHDETVRRVKNLHLSDCLRA
NKSTSAWGLEARVPFLDKEFLELAMNIDPKEKMITKERIEKYIVRKAFDTSDDPNAEPYL
PDNILWRQKEQFSDGVGYGWIDALKDNAEIQVTDEMMKNPKPEWGDDIPDTKEAYWYRCM
FDEHFPPHCASTVERWTPTWSKQTDPSGRAIAVHAAKYDHISE
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatcttcgcctgccacgcacacccggatgtgcaaaaattcaagcccaccgcc
ctccggctcgcaaaagcgatccgacatcggggtcccgattggagcggaagcgtgacttgc
aaccagacgatattgtgccatgagcgtctcagtattgttggtgttgagagcggtgcccag
ccccttaccaacgaggatgagagcatcattctggccgtcaatggcgagatctacaaccac
aggctggtccgtaagagcttgaagaccccataccacttcaagacaacatccgactgcgag
gtcatcatccctctgtatatggaacatggcctcgacgcgcccaagtacctggatggcatg
ttctcatttgtcctgtacgacaagaagcagaaccgcacgatagccgcacgagaccccatc
ggagttacgaccttctaccagggttggtcgtcctcagagccgggcgcggtttactttgga
tccgagctcaagtgcctctaccaggtttgcgataagattgaggcattccctcccggtcac
atctatgacagcttgaccggcgagaggactcgctacttccaaccaacatggtgggaccca
aagagggtaccggaaacaccactcgatctcacaaagttgcgcgaggcgttggagaagtcg
gtcaggaaacgtcttatggccgaggtgccgtacggtgttcttctgtcaggtggtttggac
tcaagtctggtggcatcaatcgctcagcgtgagacaaagcgcctgaagaagcttgcgatt
gaggctggtcttgaggacttgcctgccgagccaacaggaaaccatgaccagggcgagggt
cttgtgggaattgacgacgagaacaagttgtcaaccatgacctaccttcctcagctcaac
tcgttctcgattggtctgccaggctcgcccgacaacaaggcagcccttgaggtggctaag
ttcctgggcacaaagcaccatgttatgaccttcacaatcgaggatggtctcaacgctctt
tcggacgtcatttaccaccttgagtcttacgacgtgaccacgatccgagcatcaaccccc
atgtacttgctttctcgtaagatcaaggctatgggtatcaagatggtgttgagcggcgag
ggcagcgacgaggcctttggtggctatctctacttccacaatgcccctgacaaggatgct
ttccacgacgagacggtccgtcgcgtcaagaacttgcacctgtccgactgcttgcgtgcc
aacaagtcgacatcagcctggggattagaggctcgtgtgccattccttgacaaggagttc
cttgagctggccatgaacattgatcccaaggagaagatgatcaccaaggagcgcatcgag
aagtacattgtccgcaaggcgttcgacacctctgacgaccccaacgccgagccgtacctg
ccagataacatcctttggcgccagaaggagcagttctctgacggtgtgggctatggctgg
atcgacgcactcaaggacaatgccgagatccaagtgaccgacgagatgatgaagaacccc
aagcccgagtggggagacgacatcccagacactaaagaggcttactggtacaggtgcatg
tttgacgagcacttccctccacactgcgcctcgacggtggagcgctggaccccgacgtgg
tctaagcagaccgatcccagtggcagagccatcgcggtccatgctgccaagtatgaccac
atcagcgagtaa

DBGET integrated database retrieval system