KEGG   Magnaporthe oryzae: MGG_01013Help
Entry
MGG_01013         CDS       T01027                                 

Definition
eukaryotic translation initiation factor 3 39 kDa subunit
Orthology
K03246  
translation initiation factor 3 subunit I
Organism
mgr  Magnaporthe oryzae
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MGG_01013
Translation factors [BR:mgr03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    MGG_01013
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 341 aa AA seqDB search
MRPILLSGHERALTQVKFNPDGDLIFSVAKDQHICVWFAHNGERLGTYHGHQGAIWTVDC
DPTSTIIATGSADNTIKLWEIKTGRCLHTWEFPTAVKRVEFSPDGTRLLGVTEKRMGHLG
TIVVLDVKLDVDAEQNPERAMTIVCDESKATVAGWSYLAKYIIAGHEDGSVSQYDAKNGD
QLHSVQIHDMGSEIRDLQWSQDRTYFITASKDKTAKLVTARDLEVLKTYPADTPLNSAVI
TPKKDYVILGGGQAAMDVTTTSARQGKFEARFYHKIFEDEIGRVRGHFGPLNYVAAEPNG
KGYASGGEDGYVRVHQFDKGYFDFMYEVERERKNKMEQAQQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagacccatccttctttcgggccacgaaagggccctgacccaagtcaaattcaacccc
gacggcgacctcatcttctcggtagccaaggatcagcacatctgcgtctggttcgcacac
aatggcgagcgcctgggtacctaccacggccaccagggtgccatctggaccgtcgactgc
gacccgaccagcaccatcatcgctactggttccgccgacaacaccatcaagctgtgggag
atcaagacgggccgctgcctccacacctgggagttccccaccgccgtcaagagggtcgag
ttcagccccgacggcactaggctgctcggtgttaccgagaagcgcatgggccacctcgga
accatcgtcgtcctcgacgtcaagcttgacgttgacgcagagcagaaccccgagagggcc
atgaccatcgtctgtgacgagagcaaggccactgttgctggatggagttaccttgccaag
tatatcattgccggtcacgaggacggctcagtctcgcaatacgacgccaagaacggcgat
caactccactcagttcagatccatgacatgggtagtgagatcagggaccttcagtggtcg
caggaccgcacttacttcatcacggcctccaaggacaagaccgctaagctcgtcactgcc
cgggacctcgaggttctcaagacataccccgcggatacaccgctgaatagcgctgtcatc
acccccaagaaggactacgtcatcctcggtggtggtcaggccgccatggacgttaccacc
acctctgctcgccagggtaaattcgaggctaggttctaccataagatctttgaggacgag
atcggccgtgtcaggggtcacttcggtcctttgaactacgtcgctgctgagccaaacggc
aagggttacgcctctggcggtgaggacggttacgtccgtgtacaccagttcgacaagggc
tactttgactttatgtacgaggttgagagggaaaggaagaacaagatggagcaggcacag
caataa

DBGET integrated database retrieval system