KEGG   Magnaporthe oryzae: MGG_01076Help
Entry
MGG_01076         CDS       T01027                                 

Definition
histone deacetylase HDA1
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
mgr  Magnaporthe oryzae
Brite
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     MGG_01076
Protein phosphatases and associated proteins [BR:mgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MGG_01076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 758 aa AA seqDB search
MEEDAVMEGDGPLPVNGDSNGYPNARDIAAGFNDDQMQLQFGDDEDGDVQLHLEDDGDNE
LELYNPRDFPDDLRRRGLLPTGCCYDDRMKLHANADFGAGPHHPEDPSRIEAIFKTFKQA
GLVFTGTDSELIDIIANKPSSYMWRIPAREATKEEICLVHYAKHYDWVKELSTKPTAQLR
RLTKELDKGQTSVYVGSLTFEASLISAGGAIETCKSIVSGQIKNGFAVIRPPGHHAEQDS
AMGFCIFNNVPIAAKVCQAEYPEICQKVLILDWDVHHGNGIQNVFYEDPNVLYISLHVYK
NGEFYPGKPENPMTADGSISSCGSGPGLGRNINIGWDDQGMGDGEYIAAFQKIIMPIAHE
FNPDLVIISAGFDAAAGDQLGGCFVTPPCYAHMTHMLMSLAHGRVAVCLEGGYNLSAISK
SALAVARTLMGEPPPKMGMASPKINREAARLLAQVQAYQAPYWECMRPGVVDVEEEQRLG
SERLHDVIRQAQKWKLSKDFGMLPLYIQRENAYKSFENQVLVTPRIHLARKIMVIIHDAP
ELLAQPDPLDNHLDPHNAWVNDGVYQYINWAVKEKFGVIDVNVPQYITRPEDTDAHTRAT
DERELQRQILEITTFIWDNYLQLYDSAEDIFLIGVGAAYLGIKTLLINRECKPRISGVVS
FVTGNLRPVKSDVDPDLSTWYRDNSRIYVGSDHACWLDNDLTRKVNKRRFGAVKRSPVTG
LARMMREHAQDAQAWIRGRVRTPEDGGDTTEEDDGVRE
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagacgccgtcatggagggcgatggcccgctgccggtcaacggcgattcaaac
ggttacccaaacgccagggacatcgccgcgggcttcaacgacgatcagatgcagctccag
tttggggacgatgaggatggcgatgtgcagctccacctggaagacgatggcgacaacgag
ctggagctgtacaacccgcgggattttcccgatgacttgcgccgccgcggtctcctgccg
acgggttgctgctacgacgaccgcatgaagctccacgccaacgccgactttggcgccggc
ccgcaccacccagaggacccgtccaggatcgaggccatcttcaaaacgttcaagcaggcg
gggctcgtctttaccggcacggattccgagctgattgacatcatagcaaacaagccgtcg
tcgtacatgtggcggatccccgcgcgcgaggccacaaaggaggagatttgtctggtgcac
tacgcaaagcattacgactgggtgaaggagctgtctacaaaaccgacggcccagctgcgg
aggctcacaaaggagctggacaagggccagacgagcgtttacgtgggcagtttgacgttt
gaggcttcgctcatctcggctggtggtgccatcgagacctgcaaatccatcgtgtccgga
cagatcaagaacgggtttgctgtcatcaggccgccgggccaccacgccgaacaggactca
gccatggggttctgcatttttaataacgtaccgattgctgcaaaggtgtgccaggcggaa
tacccagagatatgtcaaaaggttttgatattggactgggacgtacaccacggcaacggg
attcaaaacgtattttacgaagacccaaacgtgctttacatatcccttcacgtctataaa
aatggcgagttctaccctggaaaacccgaaaaccccatgactgccgacggcagcatcagc
tcatgcggttccgggccagggttgggacggaatatcaacattggctgggacgaccaagga
atgggcgacggcgaatacatagctgcatttcaaaagatcatcatgcccatcgcacacgaa
ttcaacccggacctggtcatcatctcggccggattcgacgcggccgcgggcgaccagctc
ggcggctgcttcgtgacccccccatgctacgcccacatgacacatatgctaatgtctctg
gcgcacggccgcgtggccgtctgcctggagggcggttacaacttgtcggcaatctccaag
tcggccctcgcggtcgccaggacgctgatgggcgagccgccgcccaaaatgggcatggcc
agccccaagatcaacagggaggcggcacggctcctagcgcaggtccaggcgtatcaagcg
ccgtactgggagtgcatgcggcccggcgtcgtcgacgtcgaggaggagcagcggctcgga
tctgagaggcttcacgacgtgatccggcaggctcagaagtggaagctgagcaaggacttt
gggatgctgccactctatatacagcgggagaatgcgtacaagagctttgagaaccaggtg
ctcgtcacgcctaggatacacttggcgaggaagatcatggtgattatacacgatgcgccc
gagcttcttgcccagccggaccccttggacaatcatttggatcctcacaatgcttgggtg
aacgacggtgtataccagtatatcaactgggcagtcaaggagaagtttggcgtcatcgac
gtaaacgtaccgcaatacataacaaggccagaggacaccgacgcccacacccgcgccact
gacgaacgcgagctccagaggcaaatactcgaaattacaaccttcatctgggacaactac
ctacagctgtacgactctgccgaggacatattcctgatcggggtcggagctgcgtacctg
gggatcaagacactcctcatcaaccgcgagtgcaagccgcgcatctcgggcgtcgtctcg
ttcgtcacgggcaacctgcgacccgtgaaatcggatgtggacccggacctgtcgacttgg
taccgcgacaactcgcgcatctacgtcggttccgaccacgcctgttggctcgacaacgac
ctcacccgcaaggtcaacaagcgtcgcttcggcgccgtcaagcgcagccccgtcacgggc
cttgcgcgcatgatgcgcgagcacgcgcaggatgcccaggcttggatcaggggccgcgtc
aggacgcctgaggacggcggggatacgactgaggaggacgatggggtgagggagtag

DBGET integrated database retrieval system