KEGG   Magnaporthe oryzae: MGG_01537Help
Entry
MGG_01537         CDS       T01027                                 

Definition
pyrABCN
Orthology
K11541  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
mgr  Magnaporthe oryzae
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mgr00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mgr00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 2241 aa AA seqDB search
MAARVFPPASARIVDSASDNKLICLELEDGSAYQGYSFGAPKSIAGELVFQTGMVGYPES
VTDPSYRGQILVITFPLVGNYGVPSRETMDELLGDLPAHFESSQIHIAGLVAASYSGEDY
SHYLATSSLGTWLKEQGIPAMYGVDTRGLTKHIRNHGSMLGRMLLQRASATESGNELFVT
KFATPDWSQYFETVDWVNPNKKNLVAEVSIKAPKLYKPPQNVALKHPSGRPIRILCLDVG
MKYNQLRCFLKRGVEVLVCPWDYDVSKGAGTEYDGLFLSNGPGDPSVVQDTVKRISAAVA
ANKTPIFGICLGHQLLARASGATTIKMKFGNRGHNIPCTSMVTGKCHITSQNHGFAVDAA
TLPTGWKELFVNANDGSNEGIMHVDQPHFSVQFHPESTPGPRDTEFLFDVFINTVVKCAA
DSSLLQKPVSFPGGTLEENERLHPRVHVKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKE
EGIYTVLINPNIATIQTSKGLADKVYFLPVNADFVRKVIKYERPDAIYVTFGGQTALSVG
IQLKDEFEELGVKVLGTPIETIITTEDRELFARSMESIGEKCAKSASASSVDECMRVVKD
IGFPVIVRAAYALGGLGSGFANNEAELLDLCNKALAASPQVLIERSMKGWKEIEYEVVRD
AQDNCITVCNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNI
QYALNPFSKEYCIIEVNARLSRSSALASKATGYPLAFIAAKLGLGIPLKEIKNSVTKVTC
ACFEPSLDYVVVKMPRWDLKKFTRVSTLLGSSMKSIGEVMSIGRSFEEAIQKAIRAIDFH
NLGFNETKALMSIDDELQTPSDQRLFAIANAMASGYTVDKIWEMTKIDKWFLNKLKGLSD
FAKTMSGFSKDNISGRPDLLLEAKRLGFSDRQLAKFWSSNELAVRSLRLEAGITPFVKQI
DTVAAEFPAFTNYLYLTYNATEHDIALDDHGVMVLGSGVYRIGSSVEFDWCSVRAIRTLR
QQGYKTIMVNYNPETVSTDYDEADKLYFENINLETVLDIYEMEAANGILGAMGGQTPNNI
ALPLHRYGAKILGTSPEMIDTAENRFKFSRMLDRIGVDQPTWKELTSFEEAKKFCQAVSY
PVLVRPSYVLSGAAMNTVYSEADLESYLKQAAEVSREHPVVITKYIENAKEIEMDAVAKD
GKVVGHFVSEHVENAGVHSGDATLILPPQDLEKTTIERIEEATRKIAGALNVTGPFNIQF
IAKDNDIKVIECNVRASRSFPFVSKVMGVDLIEMATKAIMSVPFEAYPEEERTSSAVACK
VPQFSFSRLSGADPVLGVEMASTGEVACFGRDKYEAYLKALLSTGFKIPKNNILLSIGSY
KDKKEMLPSVANLQRLGYKLFATAGTADFLQEHGIPVQYLEALGSEDDGQKSEFSLTQHL
SNNMIDLYINLPSSNKYRRPANYMSKGYQTRRMAVDYQIPLVTNVKNAKILVEAIARHFE
LEVGLRDYQTSHRTMILPSLINIAAFVPGIVSLGSKDLSTVTRASVAAGFSMIRVMPVGV
DGAITDAKSLKVAQQNAKSDTYCDFNLSVSATSSNSDQISQVMAEVGSLFIPFNHLSDNI
SKVAAVTAHFDSWPAHKPIITDARTTDLASILLLASLHNRRIHVTCVTSKDDIRLIELSK
QKGLKVTCDVSVYCLYLSQKDYPDCQQLLPTYEDQQALWEHMSTIDVFSIGSLPYQLAHT
LSHDTDAAVGIADVLPLLLTSVSEGKLTMDDIKSRLHDNPMEIFELHEQVGTSVEVELNR
SYTLPKSTNWSPFAGRQVRGSVQRVTFEGKVVCLDGQALPVLAMGKDMSTHNALPSLPMS
PPLKAAQQIPESPVIRRQSMLSSGPRPLLRPRYIDSAMSALSPTVNKSAVDTEIPSQSIP
PAVSTSSLGELLSAPSRFKNQHVLSVHEYKRSDLHHLFTVAQEMRLGVQRDGVLDVLRGR
VLCTLFYEPSTRTSASFDAAMQRLGGRTIAIATSHSSVQKGETLQDTLRTVGQYGDAVVL
RHPQEQSVDIAQKFSQVPVINGGNGSKEHPTQAFLDLFTIREELGTVQGLTITFVGDLLY
GRTVHSLANLLRHYEVRIQLVSPKSLSLPAYVRNQLVERGQLLCESETLTQEIVARSDVL
YCTRVQKERFPSAEAYEAVKGAYRIDNAMLRQAKANMIVMHPLPRNDEIAEEIDFDQRAA
YFRQMRYGLYCRMALLALVMS
NT seq 6726 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccgcgtgttccctccggcttcggcccgaatcgtcgactcggccagcgacaac
aagctcatctgcctcgagcttgaagatggctcggcttaccaaggctacagcttcggcgcc
cccaagagcatcgccggcgagctcgttttccagactggaatggtgggctatccagagtca
gtcaccgacccctcctacaggggtcagatccttgtgatcaccttccctcttgtaggaaac
tacggcgttccatctcgtgagaccatggatgagctcctgggtgacctacctgcccatttt
gagtcctcacagatccacatcgccggtctcgtggccgcctcatactctggcgaggactac
tcccactacttggccacatcctctttgggaacatggctcaaggagcagggaattccggca
atgtatggtgttgacacgagaggtctcaccaagcacattcggaaccacggaagtatgctg
ggtcgcatgctacttcaacgtgcctcggccactgagagtggcaacgagctctttgtaacc
aaattcgcaaccccagactggtcccaatatttcgagaccgttgactgggtgaaccccaac
aagaagaacctggtcgccgaggtctccatcaaggcaccaaagctctacaagcccccgcaa
aatgttgctttgaagcatccctccggccgaccgattcgcatcctctgtctcgatgttggt
atgaaatacaaccagctccgttgcttcctcaagcgcggcgtcgaggtcctagtatgccct
tgggactatgatgtctccaagggagctggcaccgagtacgatggtctcttcctctccaac
ggccctggcgacccgtccgtggtccaggacaccgtcaagcgtatctctgcggcagttgct
gcaaacaagactcccatcttcggaatttgcttgggccaccagctgttggcgagagcctcc
ggcgccacaacaatcaagatgaagttcggaaaccgcggtcacaacattccctgcacgagc
atggtgaccggaaagtgccatatcacatcgcaaaaccacgggttcgccgtggacgcagcc
acgctccctacaggctggaaggagcttttcgttaacgccaacgacggcagcaacgagggt
atcatgcatgtcgaccagccccacttcagtgtgcaattccatcccgaaagcacaccgggt
ccccgtgataccgagttcctcttcgacgtcttcatcaacactgtggtcaagtgcgccgcc
gatagcagtcttctgcagaagcctgtcagttttcccggcggcaccttggaggagaacgaa
agacttcacccccgcgtgcacgtcaagaaggtccttgtccttggaagtggtggtctgagt
atcggacaggctggagagtttgactactctggaagtcaagcaatcaaggctttgaaggaa
gagggcatctacaccgtgctcatcaacccaaacattgcgaccattcagacctctaagggt
ctggctgacaaggtctacttccttccagtcaacgccgatttcgtgcgcaaagtcattaag
tacgagcgtcccgacgctatctacgtcactttcggtggccagacggctctctcagtgggt
atccagctcaaggatgagtttgaggagctcggcgtcaaggttctcggaacacctattgag
accatcatcactaccgaggaccgtgaactcttcgctcgcagcatggagtcgattggggag
aaatgtgccaagtccgcgtcggcaagcagcgtggacgagtgcatgagggttgtcaaggac
attggcttccccgtcatcgtcagagcagcatatgctctcggtggtctcggaagtggtttt
gccaacaacgaggctgagctgcttgacctttgcaacaaggccttggccgccagtccccag
gttctcattgagagaagtatgaaaggatggaaggagatcgagtacgaggtggtgcgtgac
gcacaggacaactgcatcaccgtctgtaacatggagaactttgatccccttggtatccac
accggcgactccattgtcgtggctccctcgcaaacactttcagatgaggactacaacatg
ctgaggactaccgcagtcaacgtcattcgtcacctgggcgttgtgggtgaatgcaacatt
cagtacgcgctcaacccattctccaaggagtactgcatcatcgaagtcaacgcccgtctt
tcgagatcctctgcccttgcgtccaaggcaactggttacccccttgccttcattgcagcc
aagcttggtcttggtatccctctcaaggagatcaagaactctgttaccaaggtgacatgt
gcttgcttcgagccatctttggattacgtcgtggtcaagatgccccgctgggatctgaag
aagttcacccgcgtgtctaccttgcttggctcgtccatgaagagtattggggaggttatg
agcatcggtcgatccttcgaggaggccatccagaaggcaatccgtgccattgatttccac
aacctcggcttcaacgagaccaaggccctcatgtcgatcgatgacgagctgcaaacgccg
tcagaccagcgtctcttcgccattgcaaatgcgatggcaagcggctacactgttgacaag
atctgggagatgaccaagattgacaagtggttcctcaacaagctcaagggcttgagcgat
tttgccaaaactatgtctggcttttccaaggataacatcagcggacgtcccgacttgttg
ctggaggcaaagcgtctcggcttcagcgataggcagttggccaaattctggagctctaat
gagctcgctgttcgctccctgaggcttgaagcaggcatcacacctttcgtcaagcaaatc
gacaccgtcgcagccgagttcccggcattcaccaactacctctatctcacttacaacgca
accgagcacgacattgcacttgatgaccacggcgtgatggtcctcggctctggcgtgtac
cgtattggctcctcggttgagttcgattggtgttcggttcgtgccatcaggaccctgcgt
caacagggctacaagaccattatggtcaactacaaccctgaaactgtcagcacggattac
gacgaggcagacaagctctacttcgagaacatcaacctggagactgtgcttgacatctac
gagatggaggctgccaatggtattctcggcgccatgggtggccagacacctaacaacatc
gcactgcctctgcaccgctacggagcaaagatcctgggaacctcgcccgagatgatcgac
acggccgagaaccgcttcaagttctctcgtatgcttgatagaattggtgtggaccagccc
acctggaaagagttgacaagctttgaggaggccaaaaaattctgtcaagcagtgtcatac
ccggttcttgtccgcccatcatatgttctttcgggtgcggccatgaatactgtctactca
gaggccgacctcgagtcctacctgaagcaggctgccgaggtttctcgcgagcatcccgtg
gtcatcaccaagtacatcgaaaacgccaaagaaatcgagatggatgcggttgccaaggat
ggcaaggttgttggtcatttcgtttccgagcatgttgaaaacgccggtgttcactccgga
gacgcaacacttatccttccgcctcaagatctcgagaagacgacgattgaaaggatcgag
gaggcaactcgcaagattgcaggtgccctcaatgtcactggacccttcaacatccagttc
atcgccaaggacaacgacatcaaggttatcgagtgtaacgtccgtgcctcgcggtcattc
ccattcgtttccaaggtcatgggtgtggacctcatcgagatggcgaccaaggccatcatg
agcgttccctttgaggcgtatcctgaagaagagagaacatcgagcgctgtcgcctgcaaa
gttcctcagttcagtttctctcgtctttcgggtgctgatccagttctgggtgtggagatg
gcctcgaccggagaagtcgcctgtttcggtagagataagtacgaggcgtacctcaaggcc
ttgctctccacgggcttcaagattccaaagaacaacatattgttgtctattgggtcctac
aaggataagaaggaaatgctgccgtcggtcgccaacttgcaaagactcggctacaagctc
ttcgcgacggccggtacagccgacttcttgcaggagcacggtattccggtgcagtacttg
gaggctctgggctctgaggacgacggacagaagtcagagttctcgctcacgcagcacttg
tccaacaacatgatcgacctttacatcaaccttccctcgagcaacaagtacaggcgtccc
gccaactatatgagtaagggatatcagacccgcagaatggctgtcgactaccagattcca
ttggttaccaatgtcaagaatgccaagattcttgtcgaggctattgccaggcatttcgag
cttgaggttggcctgcgcgactaccagaccagccatcgcaccatgattctgcctagcctg
atcaacattgcggcctttgttccgggtatcgtgtctctcggcagcaaggatttgagcact
gttaccagggcatctgtggctgccggcttcagcatgatcagggttatgccggtcggcgta
gacggcgctatcacagacgccaagtctctcaaggtcgctcagcaaaacgccaagtcggac
acctactgcgacttcaacttgtcggtctcggcaacctcgagcaactcggatcaaattagc
caggtcatggccgaggttggttcgcttttcattcctttcaaccacttgtcggacaacatc
agcaaggtagctgctgtgactgctcacttcgactcttggccagcccacaagcccattatc
acagacgccaggaccacagacctggcttcgattctgctgctggcaagccttcacaaccga
cgcatccacgtcacgtgtgtgactagcaaggatgacatcaggctcattgagctgagcaag
cagaagggtctcaaggtcacttgtgatgtgtccgtctactgcctttacctgtcgcagaag
gactaccccgattgccaacagctgcttcccacctacgaggatcagcaggctttgtgggag
cacatgagcactatcgatgtgttctccattggcagtctgccctaccagctagcccatact
ttgtcgcatgataccgatgctgctgtcggtatcgctgatgtccttcccctcctgctcacg
tcggtctccgagggcaagttgactatggatgatatcaagtctcgcctgcatgacaacccg
atggagatatttgagcttcacgagcaggtcggtacttcggttgaggtggagctgaaccga
tcatacactcttcccaagtccaccaactggtccccattcgcaggcagacaagtccgaggt
tccgtgcagagggtaactttcgaaggcaaggtggtgtgcctcgatgggcaagctctccct
gttttggctatgggcaaggacatgtccactcacaacgctctgccttcgctccccatgtcg
ccccctctcaaggcagcccagcaaatccctgagagccctgtcatcaggcgccagtctatg
ctgtcctcagggcctcgtcctctcctgcggccaaggtatatcgactctgccatgtcagcc
ctgtcgcccactgtcaacaagtctgctgtcgacactgagataccttcccagagtatcccg
cctgctgtgagcacctcatcgctgggcgaattgctctccgcgccgtcacgtttcaagaac
cagcacgtgctttcggtgcatgagtacaagcgcagcgatctgcatcacctcttcactgtt
gcgcaggagatgcgtcttggcgtgcaaagggatggtgttttggacgtgctccgcggccgc
gtgctctgcactctcttctacgagccgtccacgcgcacttcggcgtcgttcgacgctgcc
atgcagcgcctgggtggccgcaccatcgcaattgcgacctcacactcgtcggtccagaag
ggcgagacactgcaggataccttgcgcactgttggccagtacggtgacgcagtggttttg
aggcaccctcaagaacaaagtgttgacattgcgcagaagttcagccaagtgccagtgatc
aacggaggaaacggaagcaaggagcatcccactcaggcgttcctggacctcttcactatc
cgtgaagagctgggtaccgttcagggcctgaccatcactttcgtgggcgatctgctctat
gggcgtacagtgcactcattggccaacctcttgcgccactacgaggttcgcatccagctc
gtttcgcccaagagtctttctcttccggcctacgtccgaaaccagctggtggagcgtggc
cagctcttgtgcgagtcagagactctgacccaggagattgtcgcgcgcagcgacgtgctt
tactgcactcgcgtacagaaggagcgtttccccagtgccgaggcatacgaagccgtgaag
ggcgcttaccgcatcgacaatgccatgttgcgccaggccaaggctaacatgattgtaatg
caccctctcccaagaaacgatgagattgcggaggagattgattttgatcagcgggctgcc
tatttcagacagatgagatacggactttactgccgtatggctctgcttgctctggttatg
tcctga

DBGET integrated database retrieval system