KEGG   Magnaporthe oryzae: MGG_01631Help
Entry
MGG_01631         CDS       T01027                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mgr  Magnaporthe oryzae
Pathway
mgr00040  Pentose and glucuronate interconversions
mgr00052  Galactose metabolism
mgr00500  Starch and sucrose metabolism
mgr00520  Amino sugar and nucleotide sugar metabolism
mgr01100  Metabolic pathways
mgr01130  Biosynthesis of antibiotics
Module
mgr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MGG_01631
   00052 Galactose metabolism
    MGG_01631
   00500 Starch and sucrose metabolism
    MGG_01631
   00520 Amino sugar and nucleotide sugar metabolism
    MGG_01631
Enzymes [BR:mgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MGG_01631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP DAO_C
Motif
Other DBs
NCBI-GeneID: 2679105
NCBI-ProteinID: XP_003714619
UniProt: G4MUC5
Position
2
AA seq 529 aa AA seqDB search
MASNVAKAVKSALPSHLKPESAETKGDSEFAPRHHGKTQSHMAFENASTNIAAAQMRNAL
TALAETVTDEKQKNLFETEMDNFFALFRRFVNDKAKGSTVDWDRIAPPAQGQVVDYDELA
NSESVEFLSKLAVLKLNGGLGTSMGCVGPKSVIEVRDGMSFLDLSVRQVEHLNRTYGTNV
PFILMNSFNTDEDTASIIKKYEGHNVDIMTFNQSRYPRILKDSLLPVPKSYDSNIDAWYP
PGHGDVFESLYNSGVLDKLIERGIEYIFLSNVDNLGAVVDLRILQHMVETGAEYIMELTN
KTKADVKGGTIIDYEGKVRLLEIAQVPKEHVNEFKSIKKFRYFNTNNIWMNVQAIKRVVE
NHELEMEIIPNGKTIPGDKKGESDISIIQLETAVGAAIRHFNNAHGVNVPRRRFLPVKTC
SDLMLVKSDLYTVKHGQLQMSAARFGDAPLIKLGTDFKKVSDFQKRISSIPKMIELDHLT
ITGAVNLGRGVTFKGTVIIVATEGQTIDIPPGSILENVVVQGSLRLLEH
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaatgtcgctaaggcggtcaagagcgccctgccctcccacctcaagcccgag
tctgctgagacaaagggcgattccgagtttgctccccgccaccatggcaagactcagtct
cacatggctttcgagaatgcctccacaaacatcgccgctgcccaaatgcgcaacgcgctg
actgcgctggcagagacggtcactgacgagaagcaaaagaatctgtttgagaccgagatg
gacaacttcttcgcgctcttccgccgttttgttaacgacaaggccaagggctctacagtc
gactgggaccgcatcgcaccacctgcgcaaggccaggttgttgactacgatgaactggca
aactcggagtctgttgagttccttagcaagctcgcagtcttgaagctcaacggtggtctt
ggtacctcgatgggttgcgtcggacccaagtcggtcattgaggttcgagatggcatgtcc
ttcctcgacctctcagtccgccaggtcgagcacctgaaccgcacatacggcaccaacgtc
ccgttcatcctgatgaactcgttcaacactgatgaggacaccgcctccatcatcaagaag
tacgagggacacaacgttgatatcatgaccttcaaccagtcaagatatcctcgtatcctc
aaggactctctcctgcccgtcccaaagagctacgactccaacatcgacgcctggtaccct
cccgggcacggtgacgtttttgagtcgctctacaactctggagttcttgacaagctcatt
gagcgcggtattgagtacatcttcttgtccaacgtggacaacttgggtgccgtcgtcgac
ctccgcatccttcagcacatggttgagactggtgccgagtacatcatggagcttaccaac
aagaccaaggccgatgtcaagggtggtaccatcatcgactacgagggcaaggtccgcctc
ctcgaaatcgctcaggtccccaaggagcacgtcaacgagttcaagagtatcaagaagttc
aggtacttcaacaccaacaacatctggatgaacgtgcaggccatcaagcgcgtcgtcgag
aaccatgagctggagatggagatcattcccaatggaaagactatccccggtgacaagaag
ggcgagtcagacatttctatcatccagctcgagaccgctgtcggtgccgccatccgccac
ttcaacaacgctcacggtgtcaacgtgccccgtcgccgcttcttgcccgtcaagacttgc
tccgacctgatgcttgtcaagtctgacctctacactgtcaagcacggccaactgcaaatg
agcgccgcccgctttggagatgcgccgctcatcaagctgggaaccgatttcaagaaggtc
tcggacttccagaagcgcatctcttctatccccaagatgatcgagctcgaccacttgacc
atcaccggcgccgtcaacctgggccgtggtgttaccttcaagggtaccgtcatcattgtc
gctaccgagggtcagaccatcgacatccccccgggatccatcctggagaacgtagtcgtg
cagggtagcttgaggctcttggagcactga

DBGET integrated database retrieval system