KEGG   Magnaporthe oryzae: MGG_01631Help
Entry
MGG_01631         CDS       T01027                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mgr  Magnaporthe oryzae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MGG_01631
   00052 Galactose metabolism
    MGG_01631
   00500 Starch and sucrose metabolism
    MGG_01631
   00520 Amino sugar and nucleotide sugar metabolism
    MGG_01631
Enzymes [BR:mgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MGG_01631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 529 aa AA seqDB search
MASNVAKAVKSALPSHLKPESAETKGDSEFAPRHHGKTQSHMAFENASTNIAAAQMRNAL
TALAETVTDEKQKNLFETEMDNFFALFRRFVNDKAKGSTVDWDRIAPPAQGQVVDYDELA
NSESVEFLSKLAVLKLNGGLGTSMGCVGPKSVIEVRDGMSFLDLSVRQVEHLNRTYGTNV
PFILMNSFNTDEDTASIIKKYEGHNVDIMTFNQSRYPRILKDSLLPVPKSYDSNIDAWYP
PGHGDVFESLYNSGVLDKLIERGIEYIFLSNVDNLGAVVDLRILQHMVETGAEYIMELTN
KTKADVKGGTIIDYEGKVRLLEIAQVPKEHVNEFKSIKKFRYFNTNNIWMNVQAIKRVVE
NHELEMEIIPNGKTIPGDKKGESDISIIQLETAVGAAIRHFNNAHGVNVPRRRFLPVKTC
SDLMLVKSDLYTVKHGQLQMSAARFGDAPLIKLGTDFKKVSDFQKRISSIPKMIELDHLT
ITGAVNLGRGVTFKGTVIIVATEGQTIDIPPGSILENVVVQGSLRLLEH
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaatgtcgctaaggcggtcaagagcgccctgccctcccacctcaagcccgag
tctgctgagacaaagggcgattccgagtttgctccccgccaccatggcaagactcagtct
cacatggctttcgagaatgcctccacaaacatcgccgctgcccaaatgcgcaacgcgctg
actgcgctggcagagacggtcactgacgagaagcaaaagaatctgtttgagaccgagatg
gacaacttcttcgcgctcttccgccgttttgttaacgacaaggccaagggctctacagtc
gactgggaccgcatcgcaccacctgcgcaaggccaggttgttgactacgatgaactggca
aactcggagtctgttgagttccttagcaagctcgcagtcttgaagctcaacggtggtctt
ggtacctcgatgggttgcgtcggacccaagtcggtcattgaggttcgagatggcatgtcc
ttcctcgacctctcagtccgccaggtcgagcacctgaaccgcacatacggcaccaacgtc
ccgttcatcctgatgaactcgttcaacactgatgaggacaccgcctccatcatcaagaag
tacgagggacacaacgttgatatcatgaccttcaaccagtcaagatatcctcgtatcctc
aaggactctctcctgcccgtcccaaagagctacgactccaacatcgacgcctggtaccct
cccgggcacggtgacgtttttgagtcgctctacaactctggagttcttgacaagctcatt
gagcgcggtattgagtacatcttcttgtccaacgtggacaacttgggtgccgtcgtcgac
ctccgcatccttcagcacatggttgagactggtgccgagtacatcatggagcttaccaac
aagaccaaggccgatgtcaagggtggtaccatcatcgactacgagggcaaggtccgcctc
ctcgaaatcgctcaggtccccaaggagcacgtcaacgagttcaagagtatcaagaagttc
aggtacttcaacaccaacaacatctggatgaacgtgcaggccatcaagcgcgtcgtcgag
aaccatgagctggagatggagatcattcccaatggaaagactatccccggtgacaagaag
ggcgagtcagacatttctatcatccagctcgagaccgctgtcggtgccgccatccgccac
ttcaacaacgctcacggtgtcaacgtgccccgtcgccgcttcttgcccgtcaagacttgc
tccgacctgatgcttgtcaagtctgacctctacactgtcaagcacggccaactgcaaatg
agcgccgcccgctttggagatgcgccgctcatcaagctgggaaccgatttcaagaaggtc
tcggacttccagaagcgcatctcttctatccccaagatgatcgagctcgaccacttgacc
atcaccggcgccgtcaacctgggccgtggtgttaccttcaagggtaccgtcatcattgtc
gctaccgagggtcagaccatcgacatccccccgggatccatcctggagaacgtagtcgtg
cagggtagcttgaggctcttggagcactga

DBGET integrated database retrieval system