KEGG   Magnaporthe oryzae: MGG_01683Help
Entry
MGG_01683         CDS       T01027                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
mgr  Magnaporthe oryzae
Brite
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MGG_01683
Peptidases [BR:mgr01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   MGG_01683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 252 aa AA seqDB search
MASSTGNPAAPEVGGTRPAFIPLEANPELMTELVHGLGLSSALQMHDVFSIDDPEMLAFI
PRPALALLLVFPVSAIYESHRLAEDSLLADYAGKGPDEPVMWFRQTIRNACGMMGILHAT
LNGPAKNFIDADSTLDKLLKDATPLEPAARSKLIETNGALAQQNKAVASRGDTAAPEATD
DVDLHYVCFVKAEDGTLWELDGRRKGPLARGKLEDSEDVLSEKALVLGPRKFLEREGGDM
RFSCVALAQSMD
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggcatccagcacaggaaacccggcagcgcccgaagtaggaggcaccaggccggcgttc
ataccgctcgaggccaacccggagctgatgacggagctggtgcacggcctgggccttagc
agcgctctgcagatgcacgacgtcttctccatcgacgacccggagatgttagccttcatc
ccgcggcccgccctggccctgctgctggtcttccccgtctcggccatctacgagtcgcac
cgcctagccgaggactcgctcctggccgactacgccggcaagggccccgacgagcccgtc
atgtggttcaggcagaccatcaggaacgcctgcggcatgatgggcatcttgcatgccacc
ctgaacggccctgccaagaactttatcgacgccgattcaactcttgacaagcttttgaag
gacgccacgccgctcgagccggcggcccgctccaagctgatagagaccaacggcgccctc
gcgcagcagaacaaggcggtcgcctcacggggtgacaccgcggcgcccgaggccaccgac
gacgtggacctgcactatgtctgcttcgtcaaggcggaggacggcacgctctgggagctt
gacggccggcgaaagggtccgcttgcgcgcggcaagctcgaggactcggaggacgtgctg
tctgagaaggctcttgtgctgggaccccgcaagttcctcgagcgggagggaggggatatg
cgcttcagttgcgtggctttggctcagagcatggattag

DBGET integrated database retrieval system