KEGG   Magnaporthe oryzae: MGG_01925Help
Entry
MGG_01925         CDS       T01027                                 

Definition
bifunctional unspecific monooxygenase/NADPH--hemoprotein reductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
mgr  Magnaporthe oryzae
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    MGG_01925
  Amino acid metabolism
   00380 Tryptophan metabolism
    MGG_01925
Enzymes [BR:mgr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     MGG_01925
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     MGG_01925
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 1120 aa AA seqDB search
MAATQSRDWASFGVSLPSTALGRHLQAAMPFLSEENHKSQGTVLIPDAQGPIPFLGSVPL
VDPELPSQSLQRLARQYGEIYRFVIPGRQSPILVSTHALVNELCDEKRFKKKVAAALLGL
REAIHDGLFTAHNDEPNWGIAHRILMPAFGPMAIKGMFDEMHDVASQMILKWARHGSTTP
IMVSDDFTRLTLDTIALCSMGYRFNSFYHDSMHEFIEAMTCWMKESGNKTRRLLPDVFYR
TTDKKWHDDAEILRRTADEVLKARKENPSGRKDLLTAMIEGVDPKTGGKLSDSSIIDNLI
TFLIAGHETTSGMLSFAFYLLLKNPTAYRKAQQEIDDLCGREPITVEHLSKMPYITAVLR
ETLRLYSTIPAFVVEAIEDTVVGGKYAIPKNHPIFLMIAESHRDPKVYGDDAQEFEPERM
LDGQFERRNREFPNSWKPFGNGMRGCIGRAFAWQEALLITAMLLQNFNFVMHDPAYQLSI
KENLTLKPDNFYMRAILRHGMSPTELERSISGVAPTGNKTPPRNATRTSSPDPEDGGIPM
SIYYGSNSGTCESLAHKLAVDASAQGFKAETVDVLDAANQKLPAGNRGPVVLITASYEGL
PPDNAKHFVEWLENLKGGDELVDTSYAVFGCGHQDWTKTFHRIPKLVDEKLAEHGAVRLA
PLGLSNAAHGDMFVDFETWEFETLWPALADRYKTGAGRQDAAATDLTAALSQLSVEVSHP
RAADLRQDVGEAVVVAARDLTAPGAPPKRHMEIRLPKTGGRVHYSAGDYLAVLPVNPKST
VERAMRRFGLAWDAHVTIRSGGRTTLPTGAPVSAREVLSSYVELTQPATKRGIAVLAGAV
TGGPAAEQEQAKAALLDLAGDSYALEVSAKRVGVLDLLERFPACAVPFGTFLALLPPMRV
RQYSISSSPLWNDEHATLTYSVLSAPSLADPARTHVGVASSYLAGLGEGDHLHVALRPSH
VAFRLPSPETPVVCVCAGSGMAPFRAFAQERAALVGAGRKVAPLLLFFGCREPGVDDLYR
EELEGWEAKGVLSVRRAYSRRTEQSEGCRYVQDRLLKNRAEVKSLWSQDAKVFVCGSREV
AEGVKEAMFKVVAGKEGSSEEVQAWYEEVRNVRYASDIFD
NT seq 3363 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaactcagtctcgagattgggcgtcttttggggtttctctaccatctacagct
ttgggaagacacttgcaggcggccatgcctttcctgtccgaagaaaaccacaagtcccag
ggcacagtgctcatccctgatgcccagggcccgattccgtttcttgggtcagtccccctc
gtggacccggagctgccgtcgcagtcactgcagcgtcttgcccggcaatatggcgaaatc
taccggtttgtaattccgggcaggcaatcccctatacttgtttcaacccacgcgctcgtc
aacgagctctgcgacgaaaagcggttcaagaagaaggttgcagcggcccttttgggtctt
cgggaggctattcatgacggtctatttacggctcataacgatgagccaaactggggtatc
gcacatcgcatccttatgccagcctttgggccaatggcaatcaaggggatgtttgacgag
atgcacgacgtagcttcccagatgatcctcaagtgggcgaggcatgggtctacaacaccc
attatggtatctgacgactttacacgtctgacgctggacactatcgctctctgctcaatg
ggttaccgcttcaactctttctaccacgatagtatgcatgagttcatcgaggccatgact
tgctggatgaaggaatcgggcaacaaaactcggcggctgcttccggatgttttctaccgg
acgaccgacaagaagtggcacgacgacgccgaaatcttgaggaggaccgccgatgaggtg
ctgaaagcacgcaaggagaatccttcgggacgcaaggaccttttaactgccatgattgag
ggggtcgaccccaaaacgggcgggaaactaagtgacagcagcattatcgacaaccttatc
acattcttaatcgctggccacgaaactacatccggcatgctctcgtttgcattttatctc
ctgctgaaaaacccgactgcatatcgcaaggctcagcaagaaatagacgacctatgtggt
agggaaccgattacagtagagcatctgtccaagatgccctatatcacggctgttctccgc
gagactctccgactgtattcaaccattcccgcattcgttgtggaggcaatagaagatact
gtggtagggggtaaatacgccatccccaaaaaccatcctatttttctcatgatagcggag
tcacatcgcgaccccaaggtatacggcgacgatgcccaagagttcgagcccgagcgaatg
ctcgatggacaatttgaacgtcgaaaccgcgagttccccaacagttggaagccctttggt
aatggcatgagggggtgcatcggtcgcgcctttgcctggcaagaggctcttctcatcacc
gcgatgctgctgcagaactttaattttgttatgcacgaccccgcataccagctgagcatc
aaggagaacctgaccctgaagcctgacaatttttacatgcgcgccattctccgacacggc
atgtcaccaacggaacttgagcgctccatctcgggcgttgcacctaccggcaacaaaacg
cccccgcggaacgcgacaagaacatccagcccggacccagaagatggcggtattcccatg
agcatctattacggctccaacagcggcacttgcgagtctctcgcccacaagctcgccgtg
gatgcctcggcccagggcttcaaggccgagacggtcgatgtgctcgacgccgccaaccag
aagctgcccgccggcaacaggggcccggtggtactcatcacggcgtcctacgagggcctc
ccgcccgacaacgccaagcattttgtcgagtggctcgagaacctcaagggaggtgacgag
ctcgtcgacacaagctacgccgtgtttggctgcggccaccaagactggacaaagaccttt
caccgcataccgaagctcgtcgacgaaaagctggccgagcacggcgcggtgcggctggcg
cctctgggactgtcaaacgccgcgcacggcgacatgtttgtcgactttgagacgtgggag
tttgagaccctgtggcctgcgctggccgacaggtacaagaccggggcggggaggcaggat
gctgccgcgacggacctcacggcggcactgtcgcagctcagcgtcgaggtctcacacccg
cgcgccgcggacctccgccaggacgtcggcgaggccgtcgtcgtcgccgcgcgcgacctg
acggcccccggagccccgccgaaacgccacatggagatccgcctgcccaagacgggcggg
cgcgtccactattcggccggcgactacctcgccgtcctgcccgtgaaccccaagtcgacg
gtcgagcgggcgatgcgccggttcggcctggcctgggacgcgcacgtcaccatccgatcg
ggcgggcgcacgacgctcccgacgggggcgcccgtgtcggcgcgcgaggtgctcagctcg
tacgtggagctgacgcaaccggctaccaagcgcggcatcgccgtgctggccggagccgtg
accggcggccccgccgcggagcaggagcaggccaaggcggcgctgctggacctggctggc
gactcgtacgcgctcgaggtcagcgccaagcgcgtcggggtgctggacctgctggagagg
ttcccggcgtgcgcggtgccgttcgggacgttcctggcgctgctgccgcccatgcgcgtg
cggcagtactccatctcgtcgtcgccgctgtggaacgacgagcacgcgacgctgacgtac
tctgtcctctcggcgccgtcgctcgccgacccggccaggacgcacgtcggcgtcgccagc
agctacctcgccggcctgggcgagggcgaccacctgcacgtggcgctgcggccgtcgcac
gtcgcgtttcggctgccgtcgcccgagacgcccgtggtctgcgtatgcgccgggtctggc
atggcgccctttcgtgcgtttgcgcaggagcgcgccgcgctggtcggggcgggccgcaag
gtcgcgccgctgctgttgttctttggctgtcgcgagccgggggttgacgatctctaccgc
gaggagctggagggctgggaggccaagggggtgctgtccgtacggcgggcgtatagccgc
aggacggagcagagcgaggggtgcagatatgtccaggacaggctgctgaagaatcgggca
gaagtcaagagtctctggagccaggacgccaaggtgtttgtctgcggcagccgtgaggta
gctgaaggcgtcaaggaggccatgttcaaggtcgtggctggcaaggagggcagcagcgag
gaggtgcaggcttggtatgaagaggtgaggaatgtgcgttatgcttcggatatctttgac
tga

DBGET integrated database retrieval system