KEGG   Magnaporthe oryzae: MGG_01978Help
Entry
MGG_01978         CDS       T01027                                 

Definition
eukaryotic translation initiation factor 3 subunit B
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
mgr  Magnaporthe oryzae
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:mgr03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 746 aa AA seqDB search
MAPSYEHLREADLDEDEFDEDEVDVSDLREKFEVQLEQGFDTFVVIDGLPEVTEEQKPKL
VKFLLKKLTSVGKTKEDMIDMPMGPDGKSLRFAFVEYSSPGEAAAAVRQLDRVPLDKKHT
LRVNKLMDVDRFGREGRIDDEYQPPHIDEFHPRDHLRSFMADPSGRGRDQFVMFRGDHVG
VFWNNEKDTPENIVDRPNWTESFVQWSPLGTYLLSMHMQGVQLWGGPKWDRLGRFPHPFV
NMAAFSPQENYLVTWSNRPISIPDEGHPALSMDDDGKNYVIWDIATGKPLRSFANLDLPP
DDPNKPPRKHPWPAFKWSSDDKYVARLTQGQSISVYELPRMNLLDKTTIKVEGVQDFEWA
PSRPQRDGVKTYEQMFCYWTPEIGSNPAKVGLMSIPSKEVVRSLNLFSVSDVKLHWQSEG
AYLCVKVDRHSKSKKSQATTLEIFRVKEKGVPVEVVDTIKDTVINFAWEPKGDRFLIITT
VTPTGEVAVQPKTAISFFCPEKSKGSTVGNFKHLRTLDKRNSNAIYWSPKGRFVVVATVH
NQNSSDLDFFDLDFEGEKPEGEKDLTANLQLMNTADHYGITDVEWDPSGRFVATWASAWK
HTMENGYHMYDFKGEQLREEAVEKFKQLQWRPRPPTLLAKEEQKQIRKNLREYSRVFEQE
DAERIAGADQEVVDNRRRILEDWYEWRESVDVEVDEESAAMGVSSNPAEELLKAKTAEIL
ASGQEEEQVIEEIVEEVLEESEEIVS
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atggctccgtcatacgagcacctccgcgaggcggacctggacgaggatgaatttgacgag
gatgaggtcgacgtttctgacctccgcgagaagttcgaggtgcagttggagcaaggcttc
gacacatttgtggttatcgatggcctgccagaggtcacggaggaacagaagcccaagctt
gtcaagttcctgttgaagaagctgacctcggtcggcaagacaaaagaggacatgattgat
atgcccatgggtcctgatggcaagtcacttcggtttgctttcgtcgagtactcttcgccc
ggcgaggccgctgctgcggttaggcagctggaccgcgttcccctcgacaagaaacacaca
cttcgcgtcaacaaacttatggatgtcgaccgtttcggacgcgagggcaggatagatgac
gagtaccagccaccccacattgacgaattccacccaagggatcacctgcgctcgttcatg
gccgacccttcgggccgtggccgcgaccagttcgtcatgttccgcggcgaccacgtcggt
gttttctggaacaacgagaaggataccccagagaacattgtggacaggccaaactggacc
gagagcttcgttcagtggtctcctcttggcacatacttgttgtcaatgcacatgcaaggt
gtgcagctctggggaggcccaaaatgggacaggttaggccggtttcctcacccgttcgtg
aacatggccgccttctctccccaagaaaactaccttgtcacctggtcaaaccgccccata
tctatcccggacgaaggccaccctgctctttccatggacgacgatggcaagaactacgtg
atctgggatatcgcaacaggcaagccgcttaggtctttcgccaatctcgacctgccccct
gacgaccccaacaagcccccacggaagcacccctggcctgctttcaagtggtcatccgat
gacaagtacgtcgcgaggttgacccagggccagtccatctcggtgtatgagctgccgcgc
atgaacctgctcgacaagactacgatcaaggttgagggtgtccaagacttcgagtgggca
ccgtcacgcccgcagcgagatggagtcaaaacctatgagcagatgttctgctactggaca
ccggaaattggcagcaaccctgccaaggtcggtctgatgtccattccctcgaaggaggta
gtccgctcgcttaaccttttcagtgtgtccgatgtgaagctacattggcaatctgagggt
gcttatctctgtgtcaaggttgacaggcactcgaagtctaagaagtctcaggcaacaacg
ctggagatcttccgtgtcaaggagaagggagttccggttgaagttgtcgacaccatcaag
gatactgttatcaactttgcatgggagcccaagggtgaccgcttcctcattatcacaaca
gtcacgccaactggtgaagtggccgttcaacctaaaaccgccatatccttcttctgcccc
gagaagtcaaagggatccacagtcggcaacttcaagcacctacgaactctggacaaaagg
aacagcaacgctatttactggtcgcctaagggtcgattcgtcgtggtcgccactgttcac
aaccagaacagctctgatctggacttcttcgacctggactttgagggcgagaagcccgag
ggcgagaaggacttgaccgcaaacctgcagctcatgaacacggctgaccactatggcata
acagacgtcgagtgggatccttctggacgtttcgtggccacctgggcttctgcatggaag
catactatggagaacggctaccacatgtacgacttcaagggcgagcagctccgtgaagag
gctgttgaaaagttcaagcagcttcagtggaggccgcgaccccctacactgctcgccaag
gaggagcagaagcagattcgtaagaacctccgcgagtactcacgcgtctttgagcaagag
gatgccgagcgcattgctggcgcagaccaagaggttgtcgacaacagacgtcgtattctc
gaggactggtacgagtggcgcgagtctgtcgatgtggaggttgatgaggagagcgccgca
atgggtgtctcctccaacccggccgaggagttactcaaggccaagacggctgagatcctt
gcaagcggccaggaggaggagcaagtcattgaggagattgttgaggaggtgcttgaggag
agcgaggagattgtgagctaa

DBGET integrated database retrieval system