KEGG   Magnaporthe oryzae: MGG_02444Help
Entry
MGG_02444         CDS       T01027                                 

Definition
phosphoinositide-specific phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mgr  Magnaporthe oryzae
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mgr00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:mgr04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1145 aa AA seqDB search
MMTSSTTSAVMAERSPAASPSSTPSSMTPHTFPVHPRRIRPSNLQTNFTSSPHQVAIPPS
AISASSVSVASSLQGSPVFSLDAAPGLTQSSSIQASPEPLRGRDPEQYPSGFQLPEPVLP
QSSLSRKTSMGSLYQPAQPSGNSSLPEVPNKGLFRRLSNKATNTFRSPRRQSSAHGTKRG
ASVGPGLARPRQRSNSDLTNPFTDSDDEPFIDLDDKISFLNISVESNGRDLSPTSAPASI
NGSNSSSGPMTVVAGPTYPLELLQGTKVTKFAKKRGSTTSRKQLMLVLDAESAKITWDKS
KPSKSIYIDDIKDIRTAEDIRQYRLDFGIPESEEPLCFSIIYATHDVKPKTKMMHLVAGD
PAIVDMWVSTLHTISMHRQDIMSSLMAFNDKAIRTYWKNELHKQLKNTSNNGEENIDFLG
VERVCQNLHIHVSSETLKEKFLEALGTSSVDADASVKNGRLNFSQFQEFVRLMKRRADIR
PIFRERASDIERGMTLLDFVSFLTDVQNEDVDADRAYWEAIFARFAKRNKSKDLEGDDVP
RISEAALVSFLTSTYNVPIVSAPKNYTLDRPINEYYISSSHNTYLLGRQVMGFSSVEGYI
SALMRGCRSVEVDCWDGGDGWPLVSHGWTMTTNIAFREVMNVINKYAFVKSEFPLWISLE
VHCNPDQQRKMVAIMKEIFGARLVTEPLEGLPADKLPSPSQLKNRILIKAKKPGHEEPNP
ERTGRRRGNSLTSPYTKPVMLDNSTIPSQSLPHSPLLTPTHSQIRRMGAKTRVNTITEGR
VHDSTSGSPSDCDSGSERDIQQPISPNSGTSKIVKELGDLAVYCAGIKFSGFEHPDSKTV
NHIFSFHEGTFQRHGRPGDAKRALYRHNMRYMMRVYPHRGRVYSSNFDPLLMWRRGVQMA
ALNWQTFDLGMQLNHAMYDGGMDQSGYVLKPKEFREIQHFPYLPEHMVGGKRPRKNVKFS
IDVISAQQLMRPHNLRDRHTLDPYIEVEAFLADDKRNTNKEYSDAGPSKTKHKTPIAKDN
GFNPIFDQRYNFNFNTKYPDLIFIRWTVRLSEGGSQSDRSTILGTFTAKLTSLKQGYRTL
PLLDANGDQYLFSTLFCRIKVEAPTDIYIDYQEGTESVNKLRSLGRTVFNRSNNSPKSSV
DGGSQ
NT seq 3438 nt NT seq  +upstreamnt  +downstreamnt
atgatgacttcctctaccacatccgccgtcatggcggaaagatcaccagctgcttcaccc
agtagcacaccgtcctcaatgactccccacacatttcccgtgcacccaaggagaatacgc
ccgagcaacctgcaaacaaactttacctccagcccccatcaagtggccatccccccatct
gcaatcagtgcttcctcggtttccgtggcatcgagtttgcagggctcgcccgtcttctcc
ctggatgctgcaccaggacttacacaaagcagctcaatacaagcatccccggaaccgtta
cggggcagagatcctgaacagtacccttcagggtttcaactaccagaaccggtattacca
caatcatcgctgtcgcggaaaacaagcatggggtcactgtatcaaccagcacagccttct
ggcaactcatctttgcccgaagtcccaaacaagggcctattccgcaggctctcaaacaag
gccacaaacaccttcaggtcgccgagaaggcaatcatcagctcacggaaccaaacggggt
gccagcgttggacccggacttgccagaccacgccaacgaagtaacagcgatctcacaaac
cccttcacagactcggacgacgagccttttattgacctcgacgacaagatctctttcctc
aacatttctgttgagtctaatggccgagatttgtcaccaacaagtgccccggcatccatc
aacggtagcaattcctctagtggtcctatgactgtcgtcgctggtcccacctatcctctg
gagctactccaaggaaccaaggttacaaagttcgctaaaaagaggggctccacaaccagc
cgaaaacagctgatgctggtactggacgccgaatctgccaagatcacctgggacaagagc
aaaccttccaagtctatctacatcgacgatattaaagatatccggacggcagaagacatt
cgccagtacaggctcgactttggcattccggaatccgaggagcccctctgcttctcaatc
atctacgccacccacgacgtaaagccgaagacaaagatgatgcaccttgtggctggagat
cctgccatcgtggatatgtgggtttcgaccttgcacacaatctccatgcatcgtcaagac
atcatgtcttctctcatggcctttaacgataaggccattaggacttactggaaaaacgag
ctgcacaaacaactgaagaataccagcaacaacggtgaggaaaacatcgatttcctcggt
gttgagcgcgtgtgccaaaaccttcatattcacgtatcctccgagactttgaaggagaag
tttctggaggcgctagggacttcgtctgttgatgccgatgcatccgttaagaacggtcgt
ctcaacttcagccagtttcaggagtttgtgcgactcatgaagagacgggccgacattcgc
cccatctttcgcgaaagggcgtccgatatcgaacgtggcatgacgcttcttgacttcgtc
agttttcttacagatgtgcaaaatgaggacgtcgacgccgacagggcctactgggaggcc
atcttcgctcgctttgctaaacgcaacaagtccaaggatctggagggcgatgatgttccg
cgcatcagcgaagctgccctggtcagcttcctgacttcgacctacaatgtccccatcgtc
agcgctcccaaaaactacaccctcgaccgaccgatcaacgaatactacatctcgagctcg
cataacacctaccttctgggacgtcaagttatgggcttttccagtgtcgagggatacatc
tcggcgctgatgcgcggttgccgatccgtagaggttgactgctgggacggtggtgatggc
tggcctcttgtgtctcatgggtggacgatgaccactaacattgcctttcgcgaagtgatg
aacgtcatcaataagtacgcttttgtcaagtccgaattcccgctatggatatctctcgaa
gttcactgcaacccggaccagcagaggaagatggtggcgatcatgaaggaaatctttggg
gccaggctagtcaccgagcctctggaaggtctccccgccgacaagctcccttcgccatcg
cagctcaagaaccgtattctgatcaaggcaaagaagccgggtcacgaggagcccaacccg
gagcggaccggacgccgacgaggcaacagtctcacatctccctacacgaagccagtcatg
cttgacaactcaaccatcccttcccagtcgcttccgcacagccccctgcttactcctacg
cactcgcaaattcgccgcatgggagccaagactcgcgtcaacacaataaccgagggtaga
gtccatgattcgacgagcggtagccccagtgactgcgacagcggcagtgagcgcgatatt
cagcagcccatcagccccaacagtggcaccagcaaaattgtcaaggagcttggcgatctt
gccgtgtactgcgccggcatcaagttttctggtttcgaacacccagactccaagacggtc
aatcatatcttttccttccacgagggcacgttccaaaggcacgggaggcccggagatgcg
aagcgcgccctctaccgacacaacatgcgctacatgatgcgcgtttatcctcaccgtggc
agggtttactcgagcaacttcgacccgcttctcatgtggcgccgtggcgtgcaaatggct
gcactcaactggcagacgttcgatctgggcatgcagctcaaccatgccatgtatgatggt
ggtatggatcagtcgggctacgttctcaagcccaaggagttccgcgagatccagcacttc
ccgtacctgcccgagcacatggtgggcggcaaacggcctcgcaagaacgtcaagttcagc
attgatgtcatttctgcccagcagctcatgcgacctcacaatcttcgggatcgtcacacg
cttgacccgtacattgaagttgaggcattcctggctgacgacaagcgaaacaccaacaag
gagtactctgacgccgggccaagcaagactaagcacaagacccccatcgccaaagacaac
ggctttaaccccatcttcgaccagagatacaacttcaacttcaacaccaagtaccctgat
ctcatattcatccgatggaccgtccgtctctcggaaggcgggagccaaagcgaccgtagc
acgattcttggtacctttactgccaagcttaccagtctcaagcagggctaccgcacccta
cccctgctcgatgccaacggtgatcaataccttttctcaaccctattctgccgtatcaaa
gtcgaagctccaaccgacatctacatcgactaccaagaaggtaccgagagtgttaacaag
cttcgcagccttgggcggaccgtattcaaccgctccaacaacagtcccaagtccagcgtc
gatggcggtagtcaataa

DBGET integrated database retrieval system