KEGG   Magnaporthe oryzae: MGG_02507Help
Entry
MGG_02507         CDS       T01027                                 

Definition
(RefSeq) inulinase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
mgr  Magnaporthe oryzae
Pathway
mgr00052  Galactose metabolism
mgr00500  Starch and sucrose metabolism
mgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MGG_02507
   00500 Starch and sucrose metabolism
    MGG_02507
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     MGG_02507
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 2681604
NCBI-ProteinID: XP_003709314
UniProt: G4MKB1
Position
1
AA seq 630 aa AA seqDB search
MCLLYAGIAALLFRYPTCPANLVPAPSGTTAALPRIAPELEVAEGHRADSSEMLLSPAHS
VMFATGSVLVAASVAAAQNVMPFVNPAVPTGVPIPGNYSGPLRPRVHFTPPQHFMNDPNG
MFRDANGIWHVYYQYNPTGLVAGNQHWGHATSQDLYHWNNQKIAIFPPEETIFAYSGSIV
VDVNNTSKFFPPGKKDGVVAILTLAQFMEDGTAGPQTQALAYSMDGGFTFEYYDKNPVIG
GTSSQFRDPKVFWFQPPPGSQFMEGYWVMAVAYSHEFAVGIYTSTDLKDWTPRSNFTNRG
LLGAQYECPGLVKMPIRDGVGGPVIGEAYVLIVSVQPGAPLGGSVTQYFPGNFNGTHFFP
FDDATRLTDFAKDNYAAQYFEGLPSNMNAVNMGWASNWAYAQLTPTGQLEGWRGGLTLPR
SNYLTKAPRIGWTMVDEPYNLAPVLSVNPNDGDSELTEADSKSLDMTAWNSGAFLLDVLV
TGLEFKKLNPDASLNFTLSAPGNSSESLKFGMYFAGDRPFFIDRGHARSLFEDNVFFTDK
FSTADVWDTTPGSNWTLRAIIDRSIAEFFVDGGIHSATVTIFPSQPLSVLGVQSGGLNTG
AKVNLSVKPLQDTWVRNGRPPSGDADGDDA
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgtgtttactatacgctggaattgccgccctgctcttcagatatccaacctgcccagct
aatcttgttccagcgccctccggaaccaccgcagctctgccgcgcatagctcccgaactc
gaagtcgccgaggggcatcgagccgacagcagcgaaatgctcctatcaccggctcacagt
gtcatgtttgcgacagggtcagttcttgtggctgcctcggtggcggcagcacagaatgtg
atgccttttgtcaacccggccgtgccaacaggcgttccaatacccggcaactacagcggt
cctctccggcctcgcgtgcatttcacaccgccgcagcatttcatgaacgatccgaacggc
atgtttagggacgcaaacggtatatggcatgtctactaccaatacaacccgacaggactg
gtcgcaggaaaccagcattggggccatgccacgagccaggatctctatcactggaacaac
cagaaaatcgccattttccctcccgaggagactatttttgcctactcgggtagcatagtc
gtcgatgtcaacaatacatcaaagttcttcccccctgggaagaaggacggggttgtcgcc
attttgaccttggcccagttcatggaagacgggactgctggtcctcaaactcaggccctg
gcctactcgatggacggtgggttcacattcgagtactatgacaagaacccagtcatagga
ggcaccagcagtcagttccgggatcccaaggtcttttggttccagccgcccccgggctcg
cagtttatggaaggttactgggtcatggccgttgcctactcccacgaatttgccgtcggc
atctacaccagcaccgacctgaaagactggacgcccaggtccaacttcaccaatcgtgga
ctgctgggggcccaatacgaatgcccaggacttgtcaagatgcccataagagacggcgtc
ggcggcccggtcatcggcgaagcatacgtcctcatcgtatcggtgcagcctggtgcaccg
ctcggaggttctgtaacccagtatttccccggcaacttcaacggcacacacttttttcct
ttcgacgacgccacccgcctcaccgactttgccaaggataactacgcagcccagtacttt
gagggcctgccatcaaatatgaatgccgtcaacatgggatgggccagcaactgggcatac
gcacagctgacgccaaccggtcagctcgagggctggcggggtggtcttacactgccgcga
tcaaactacttgacaaaggctccaaggatcggctggaccatggttgacgaaccatataac
ctggcgcccgtgctctctgtcaatcccaacgacggagactctgagctgacagaggccgac
tccaaatccctcgacatgacggcctggaactctggggcgttcctactggacgtgctcgtc
acgggcctcgagttcaaaaagctcaatcccgacgcgtctctcaactttactctgtcggcc
cctggaaactcgagcgagtcactcaaatttggcatgtattttgcgggagacaggcccttc
tttatagaccgcggtcatgctcgaagcctgtttgaggacaacgtttttttcaccgacaaa
ttctccacggccgatgtgtgggacaccacgccagggtcaaactggacgttgagggcgatc
attgacagatcgatagcggagttctttgtggatggggggatacactcagcgaccgttacg
atctttccaagtcaaccgctatcggtgctgggtgtgcagagcggcgggctgaatacaggg
gcaaaggttaacctctctgtcaagccgctccaagatacttgggtacgaaatggacggcca
cctagcggtgatgccgacggcgacgatgcataa

DBGET integrated database retrieval system