KEGG   Magnaporthe oryzae: MGG_02616Help
Entry
MGG_02616         CDS       T01027                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mgr  Magnaporthe oryzae
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MGG_02616
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MGG_02616
Enzymes [BR:mgr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     MGG_02616
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 607 aa AA seqDB search
MLRTIPTRVLRRTSAAASRPASFCRCGRLLSTTPRRAMPPITSTSLPSVNPPLTAALPSD
SFHLLPEAKKAGAAEDALYEQQVRDVEAWWATPRYAGITRPYTAADVVSARGSQQQSYPS
STMARKLWNLIQERKAEGKPIHTLGAIDPIQMTQQAAHQEVLYVSGWACSSVLTSTNEVS
PDFGDYPYNTVPNQVQRLAKAQSMHDRKHWDARRKMSAQERSSTPYTDYLRPIIADGDTG
HGGLTAVTKLAKLFAEAGAAAVHFEDQMHGGKKCGHLAGKVLVSTGEHINRLTAARMQWD
IMGTENLVIARTDSESGRLISNNIDARDHEFILGVTDPSAAPLAGTLQNMEARGASASEI
DAYEAAFTRDHPLVTFDEAAVSHMKKHNVDPAEYEAGVAKDRDMSIWDRRALAKDILGAD
KPDVYWDWDVPRTREGYYHFRSGMRAATKRALAFAPYADLLWVETGDPSVSVCRQLGRAV
KEAYPEKALVYNLSPSFNWMGHGFTEQTLKSFIWDIAKEGFVLQLVSLAGVHTNATATCE
LARAFKDEGMLAYVNLVQRKEKEIGCDVLTHQKWSGAAYMDRIVGAIQSGSSTSKSMGAG
NTEGQFH
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcacgataccgacccgggtccttcgcaggacatcggctgcagcatcccgacca
gcctcattctgccgctgcggaagattgctctcgacgacgcctcgcagggcgatgcctcca
ataacgagcacttccctcccttccgtcaacccgcctttgaccgccgcccttccttccgac
tctttccatctcctccccgaagccaagaaggccggcgccgccgaagatgctctctatgag
caacaggtacgcgacgtcgaggcctggtgggcaacgcctaggtatgctggtatcaccagg
ccgtacacggctgccgatgtggtatctgcccgaggctcgcagcagcagtcatacccgagc
tcgacaatggcaagaaaactatggaacttgatacaagagcgcaaggccgagggcaaaccc
attcatactctgggtgccatcgacccaatccagatgacgcagcaggctgctcatcaagag
gtgctctatgtttccggttgggcgtgctccagcgttctgactagcacgaacgaggtgtct
ccggactttggcgactatccgtacaacacagtgcccaaccaagtacagcgccttgcaaag
gcccagtcgatgcatgatcggaaacactgggatgcacgacgaaagatgtcggcacaagaa
cgctcctctactccctacaccgattacctgcgccccattatcgcggatggcgacacaggc
catggtggcctgacagcagttaccaagcttgccaaactctttgccgaagcaggtgccgca
gctgttcactttgaagatcagatgcacggaggcaagaagtgtggccatctcgccggaaag
gtccttgtgtccacgggtgagcacatcaaccgcctgactgcggcgcgtatgcagtgggat
atcatgggtaccgaaaaccttgtcattgcccgtacggattcagagtctggtcggttgatt
agcaacaacattgatgcccgcgatcacgagtttatcctcggagtgaccgacccatcagcg
gcaccgctggcgggaactttgcagaacatggaggcgcgcggcgcatcagcttcagagatt
gacgcctacgaggctgccttcacgcgcgatcaccctctggtgacctttgacgaagcagct
gtctcacacatgaagaaacacaacgttgacccagcggagtacgaggctggcgttgcaaag
gaccgggacatgagcatctgggatcgccgagccttggccaaggacattctgggtgctgat
aagcctgatgtctactgggattgggacgttccccgtacgagagagggatactatcacttc
cgctcagggatgcgtgccgctaccaaacgcgcgctcgcctttgcgccgtatgctgatctc
ctttgggtcgagaccggcgacccctctgtctccgtctgccgacagctcgggcgcgcagtg
aaggaggcctatccggagaaggctctggtgtataacctgagcccgtcgttcaactggatg
ggtcacgggttcacggagcagacgctcaagtctttcatatgggacatcgccaaggagggc
ttcgtcctgcagctcgtgagcttggcgggtgtacacaccaacgctactgcgacgtgcgag
ctcgccagggcattcaaggacgaaggcatgctggcgtacgtcaacctggtgcagcgcaag
gagaaggagattggctgtgacgtcctcactcaccagaaatggagcggtgcggcgtacatg
gatcgcattgtcggggctatccaaagcggaagctcgactagcaagagtatgggagctggc
aacacagaaggacagtttcactaa

DBGET integrated database retrieval system