KEGG   Magnaporthe oryzae: MGG_02653Help
Entry
MGG_02653         CDS       T01027                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mgr  Magnaporthe oryzae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MGG_02653
   01230 Biosynthesis of amino acids
    MGG_02653
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGG_02653
   00030 Pentose phosphate pathway
    MGG_02653
   00051 Fructose and mannose metabolism
    MGG_02653
   00052 Galactose metabolism
    MGG_02653
  Energy metabolism
   00680 Methane metabolism
    MGG_02653
Enzymes [BR:mgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MGG_02653
Protein phosphatases and associated proteins [BR:mgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MGG_02653
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 781 aa AA seqDB search
MAPKKKIAVMTSGGDAPGMNAAVRAIVRMSIHLGCDAFCVYEGYEGLVQGGNFIRQMQAE
DVRGWLSEGGTLIGTARCMAFYERPGRLTAAKNMVLNGIDALIICGGDGSLTGADKFRAE
WPSLLEELVSKGELKEEQIAPYKHLNIVGLVGSIDNDLSGTDATIGCYSALSRICEMVDY
IEATAASHSRAFVIEVMGRHCGWLALLAGVATGADFIFIPEHPQEGNWKEGMYAVVEKHR
KLGKRKTIVIIAEGANDRNGKKITPEEVKDLLADKNGLALDTRITTLGHVQRGGRAVAYD
RIIATQMGVEAVRAVIEATPETETCFIAVNENKIVRKPLMQAVKDTKKVATAIEAQDFDQ
AMSLRDSEFAEQYQSFQIMTTPEPALLLPKEKRMKIAFINVGAPAGGMNAAIRAGVLWCQ
SRGHEAIAIHNGFAGFARHHGDKPLGAVRPFDRLEVDGWASRGGSEIGTNREVPSQSGME
LIAKLIGQYGFDALFVIGGFEAFQAVSELRRAQEEYPSLRIPMALLPATISNNVPGTEYS
LGSDTALNALVDYSDMIKQSAAATRRRVFVIETQGGKCGYLATLAGMACGASAVYTPEEG
ISLDMLAADVAHLKEIFAHDKGQSRAGRLVLVNEKASNVYNAKLIADILREEAHGRFEAR
DSIPGHVQQGGVPSPMDRSRAVRLAIKCIQHLEQYGPKPHEKVKADPRSAGVIGIRGADV
VMTPMKEVEDTETDWPNRRPLNAFWTEMKESVDILGSRGPYPRPEPTLKGLKAKDVKRGL
E
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaaaagaaaatcgccgttatgacgtccggcggcgacgccccgggcatgaac
gcagctgttcgcgccattgtccgcatgtccatacatctgggttgcgacgcattctgtgtt
tatgaaggatacgagggcttggtgcagggaggaaacttcatcaggcaaatgcaggcagag
gacgtccgaggctggctctccgagggcggaacgctgattggtacggcacggtgcatggcg
ttctacgagcggcccggacgtctcaccgcggccaagaacatggttcttaacggcatcgac
gcactcattatctgcggtggagacggttctctaacgggtgccgacaagttccgcgccgag
tggccttcgttgttggaggagcttgtaagcaaaggtgaactgaaggaggagcagattgcc
ccttacaagcacctcaacatcgttggacttgtgggctcgatcgacaatgacctgtctgga
acggacgcaacgatcggttgctactcggctctctctcgaatttgcgagatggtcgactac
atcgaggccaccgctgcatcacattcccgtgcatttgtgattgaggtcatgggaaggcat
tgcggatggcttgcactactcgccggagttgccactggtgctgacttcatcttcatcccg
gagcaccctcaggagggcaactggaaggaggggatgtatgccgtagtggaaaagcaccga
aaactgggcaagcgcaagacaatcgtaattatcgccgagggtgccaatgaccgcaatggc
aagaagatcacacccgaggaggtcaaggatctgttggcagacaagaacggtctggcattg
gatacaagaattactacactaggacacgtccagcgtggtggacgagcggttgcttacgac
cgtatcatcgccacacagatgggcgtagaggctgtcagggccgtcattgaggcaacgccc
gagacggagacttgcttcatcgctgtcaacgaaaacaagattgtccgcaagcctttaatg
caggcagtgaaagatacgaaaaaggtggccacagcaatcgaggcccaagattttgaccaa
gccatgtcgcttcgtgattccgagtttgcagagcagtaccaatcgttccaaatcatgacc
acgccggaaccggccctgcttctgccaaaggagaagcgtatgaaaattgccttcatcaac
gttggtgctccagcaggaggcatgaatgctgccatccgcgccggtgtactgtggtgtcag
tcccggggtcacgaggccattgctattcacaatggttttgcaggattcgccaggcatcat
ggcgacaagccccttggcgccgttcggccgttcgatcgacttgaggtggacggatgggca
agcaggggtggatcagagatcggcacgaaccgagaagtgcccagccagtcaggtatggaa
ctgatcgcgaaactaattgggcagtacggctttgatgcattgtttgtcattggcggattt
gaggccttccaggccgtttcggagcttcggagggcacaagaggagtacccttcactccga
atccccatggctttgctgccagcgaccatttccaacaacgttccgggtaccgagtactcg
cttggctccgacacggccctgaacgccttggtagactacagtgacatgatcaagcagtcc
gcggcggccacaaggcgacgtgtcttcgtcattgagacgcagggtggcaaatgtggttac
ctggctaccttggccggcatggcctgtggcgcaagtgctgtctacacccccgaggagggt
ataagcctcgacatgctggctgcagatgtagcccacctcaaggagatctttgcgcatgac
aagggacagtcacgggcaggccgtcttgtccttgtcaatgagaaggccagcaacgtttac
aacgctaagctcatcgccgatatcctccgtgaagaagctcacggtagattcgaggctcga
gacagcatccctggtcacgtgcaacagggtggcgtaccttctccaatggatcgctcgagg
gctgttaggctcgccatcaagtgtatccagcacctggagcagtatggtccgaagccgcat
gaaaaggtcaaggctgacccaagaagcgccggtgtcattgggattcgcggtgccgatgtc
gtcatgacgccgatgaaggaggtggaggacacggagacggactggccaaaccgccgtccc
ttgaacgctttctggaccgagatgaaggagagcgtcgatattctaggaagccgaggccct
tacccaaggcctgagccgactttgaaggggcttaaggctaaagatgtcaaacgtggactg
gagtag

DBGET integrated database retrieval system