KEGG   Magnaporthe oryzae: MGG_02653Help
Entry
MGG_02653         CDS       T01027                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mgr  Magnaporthe oryzae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MGG_02653
   01230 Biosynthesis of amino acids
    MGG_02653
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGG_02653
   00030 Pentose phosphate pathway
    MGG_02653
   00051 Fructose and mannose metabolism
    MGG_02653
   00052 Galactose metabolism
    MGG_02653
  Energy metabolism
   00680 Methane metabolism
    MGG_02653
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MGG_02653
Enzymes [BR:mgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MGG_02653
Protein phosphatases and associated proteins [BR:mgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MGG_02653
Messenger RNA biogenesis [BR:mgr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MGG_02653
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 781 aa AA seqDB search
MAPKKKIAVMTSGGDAPGMNAAVRAIVRMSIHLGCDAFCVYEGYEGLVQGGNFIRQMQAE
DVRGWLSEGGTLIGTARCMAFYERPGRLTAAKNMVLNGIDALIICGGDGSLTGADKFRAE
WPSLLEELVSKGELKEEQIAPYKHLNIVGLVGSIDNDLSGTDATIGCYSALSRICEMVDY
IEATAASHSRAFVIEVMGRHCGWLALLAGVATGADFIFIPEHPQEGNWKEGMYAVVEKHR
KLGKRKTIVIIAEGANDRNGKKITPEEVKDLLADKNGLALDTRITTLGHVQRGGRAVAYD
RIIATQMGVEAVRAVIEATPETETCFIAVNENKIVRKPLMQAVKDTKKVATAIEAQDFDQ
AMSLRDSEFAEQYQSFQIMTTPEPALLLPKEKRMKIAFINVGAPAGGMNAAIRAGVLWCQ
SRGHEAIAIHNGFAGFARHHGDKPLGAVRPFDRLEVDGWASRGGSEIGTNREVPSQSGME
LIAKLIGQYGFDALFVIGGFEAFQAVSELRRAQEEYPSLRIPMALLPATISNNVPGTEYS
LGSDTALNALVDYSDMIKQSAAATRRRVFVIETQGGKCGYLATLAGMACGASAVYTPEEG
ISLDMLAADVAHLKEIFAHDKGQSRAGRLVLVNEKASNVYNAKLIADILREEAHGRFEAR
DSIPGHVQQGGVPSPMDRSRAVRLAIKCIQHLEQYGPKPHEKVKADPRSAGVIGIRGADV
VMTPMKEVEDTETDWPNRRPLNAFWTEMKESVDILGSRGPYPRPEPTLKGLKAKDVKRGL
E
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaaaagaaaatcgccgttatgacgtccggcggcgacgccccgggcatgaac
gcagctgttcgcgccattgtccgcatgtccatacatctgggttgcgacgcattctgtgtt
tatgaaggatacgagggcttggtgcagggaggaaacttcatcaggcaaatgcaggcagag
gacgtccgaggctggctctccgagggcggaacgctgattggtacggcacggtgcatggcg
ttctacgagcggcccggacgtctcaccgcggccaagaacatggttcttaacggcatcgac
gcactcattatctgcggtggagacggttctctaacgggtgccgacaagttccgcgccgag
tggccttcgttgttggaggagcttgtaagcaaaggtgaactgaaggaggagcagattgcc
ccttacaagcacctcaacatcgttggacttgtgggctcgatcgacaatgacctgtctgga
acggacgcaacgatcggttgctactcggctctctctcgaatttgcgagatggtcgactac
atcgaggccaccgctgcatcacattcccgtgcatttgtgattgaggtcatgggaaggcat
tgcggatggcttgcactactcgccggagttgccactggtgctgacttcatcttcatcccg
gagcaccctcaggagggcaactggaaggaggggatgtatgccgtagtggaaaagcaccga
aaactgggcaagcgcaagacaatcgtaattatcgccgagggtgccaatgaccgcaatggc
aagaagatcacacccgaggaggtcaaggatctgttggcagacaagaacggtctggcattg
gatacaagaattactacactaggacacgtccagcgtggtggacgagcggttgcttacgac
cgtatcatcgccacacagatgggcgtagaggctgtcagggccgtcattgaggcaacgccc
gagacggagacttgcttcatcgctgtcaacgaaaacaagattgtccgcaagcctttaatg
caggcagtgaaagatacgaaaaaggtggccacagcaatcgaggcccaagattttgaccaa
gccatgtcgcttcgtgattccgagtttgcagagcagtaccaatcgttccaaatcatgacc
acgccggaaccggccctgcttctgccaaaggagaagcgtatgaaaattgccttcatcaac
gttggtgctccagcaggaggcatgaatgctgccatccgcgccggtgtactgtggtgtcag
tcccggggtcacgaggccattgctattcacaatggttttgcaggattcgccaggcatcat
ggcgacaagccccttggcgccgttcggccgttcgatcgacttgaggtggacggatgggca
agcaggggtggatcagagatcggcacgaaccgagaagtgcccagccagtcaggtatggaa
ctgatcgcgaaactaattgggcagtacggctttgatgcattgtttgtcattggcggattt
gaggccttccaggccgtttcggagcttcggagggcacaagaggagtacccttcactccga
atccccatggctttgctgccagcgaccatttccaacaacgttccgggtaccgagtactcg
cttggctccgacacggccctgaacgccttggtagactacagtgacatgatcaagcagtcc
gcggcggccacaaggcgacgtgtcttcgtcattgagacgcagggtggcaaatgtggttac
ctggctaccttggccggcatggcctgtggcgcaagtgctgtctacacccccgaggagggt
ataagcctcgacatgctggctgcagatgtagcccacctcaaggagatctttgcgcatgac
aagggacagtcacgggcaggccgtcttgtccttgtcaatgagaaggccagcaacgtttac
aacgctaagctcatcgccgatatcctccgtgaagaagctcacggtagattcgaggctcga
gacagcatccctggtcacgtgcaacagggtggcgtaccttctccaatggatcgctcgagg
gctgttaggctcgccatcaagtgtatccagcacctggagcagtatggtccgaagccgcat
gaaaaggtcaaggctgacccaagaagcgccggtgtcattgggattcgcggtgccgatgtc
gtcatgacgccgatgaaggaggtggaggacacggagacggactggccaaaccgccgtccc
ttgaacgctttctggaccgagatgaaggagagcgtcgatattctaggaagccgaggccct
tacccaaggcctgagccgactttgaaggggcttaaggctaaagatgtcaaacgtggactg
gagtag

DBGET integrated database retrieval system