KEGG   Magnaporthe oryzae: MGG_02874Help
Entry
MGG_02874         CDS       T01027                                 

Definition
WD repeat-containing protein mip1
Orthology
K07204  
regulatory associated protein of mTOR
Organism
mgr  Magnaporthe oryzae
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 1544 aa AA seqDB search
MMTAFTDLSCPHTARLTHKHLEPTAPDSASPQPPSARARAGQHRHHGPDSPSNATNHFHQ
FAYPPSSIASGSSGAMPSRSHTTTTTTATLPAGPAAATMAASRLAQHNSPTPLPASVTST
NGAPARRPDLQTTGSSSSPNRRPSSAPSSKHSATAALANGDGFVANHMPVTVASRSSAAA
DAASLSDRRPSSAKPKLLRSKSDFVLHSDDGYDSDPDNSDVDHHRRQGNNTKGKKISSWG
ARHGFGDHYDSEEISHLVNNWYMYFTEKRHETTGKPKLAPFEIQDWRMRDRLKTVSAAIA
VCLNIGVEPPDQLKTNPGAKMEAWQDPTVTPAQKALENIGKALQSQYETLAMRTRYKQYL
DPSVEDTKKFCLSLRKSAKDERVLLHYNGHGVPKPTSSGEIWVFNKNYTQYIPVSLYDLQ
HWLQAPTIFVWDCSEAGNILSNYHKFVEKHEKEEDEAVLRDPNHYKANFRPYIHLAACSS
SQNLPTNPLLPADLFTCCLTTPIEMALWFFVLQNPLQTGLTPERAKKLPGRLQERRTPLG
ELNWIFTAITDTIAWTTLPRHLFRKFFRQDLMVAALFRNFLLAQRVMSVYGCTPQSFPEL
PDTRQHPLWESWDLAVDQALSQLPMLERKETEGIEYEYQNSTFFTEQLTAFDVYLTRGDA
LQQKPPEQLPVVLQVLLSQQHRVRALILLGRFLDLGPWAVQLALSIGIYPYVLKLLQSAA
AELKPVMVFIWTRVLAVDTSCQQDLIKDSGYQYFSNILKPSEGLPVANSDEHKAMCAFIL
AMLCKGYKPGQVVCNQTDIMGYCLYHILNEDNPLLRQWSCLCISQLWYDLPEAKWRGIRD
NAPARLSILTKDGCSEVRAAVLYAMTTFLGIPDLTDEVARIEESIAWTVLDMANDGSPMV
RKELLVFFSHFILRYESKFLVAAYEHLLEEKEYLAYPPHDDGRENKMGLHYSRPDKRGQD
GSDRAKSQGLSHNTIIAAVWKHVNILSVDPHPEVQSHATTIVDYVHYTLLQSSLGSQSQS
LMDDVGRRARRQAARQQAQASQRNSINGGNSVGATTPLPSPGLLRRTVSTLFSPFFPVDG
PTTPTTPEPSPGLYRTSSVKSRKGAEPVVPVSTQHNDHDVSHASYHVAREPVSAGFQDRD
VTQAPKLPLQSTLLAWSIEYFLEPQMKSSESEEPGSTEYNERLWRRSRNEGILNETQPQK
LQAGRHKWNNQTGIFNTHAQPSKLNFHQFEDHVAVADDGNTIQIWDWKNQGRLSRFSNGN
PEGSRISDMKFINEEDQALLMTGSSDGVIRIYRNYDSHDDVELSSSWRALTDMVPSNVNS
GMVFDWQQVNGTTLVAGDVRVIRVWSAGQEACVTDIPARSGSCVTSLTSDQMTGNVFVAG
FGDGAVRVFDIRLRPQDSMIRKWKDETDRVWIKTVAMQRGGQRELMSASRNGKVKLWDIR
MDKPLSVFQTTKETLRTASMHEHLPVFSVGTSAHTVKVFNLDGKELSQMEPYSSFLQNRG
SPISATAFHPHHAILGCAARGDHHVNLYQCSGARIPQADEKGDA
NT seq 4635 nt NT seq  +upstreamnt  +downstreamnt
atgatgacggcattcaccgatctaagttgtccccacaccgcgcgactgacccacaagcac
ctcgaacccaccgctcctgactcggcaagccctcagcctccaagcgctcgcgctcgagct
ggccagcaccgacatcacggccccgattcaccaagtaacgcgacgaaccacttccaccag
ttcgcttacccaccatcgtcgattgcgagcggcagctccggagcgatgccgtcgaggtcg
cacacgacgacaactacgacagccacgcttcctgctgggccagcagctgcgaccatggcc
gcgtctcgccttgcgcagcacaactctcccactccccttcccgcgtccgtgacatcaacc
aacggcgcgcccgcacgacgaccggacctacagacaaccggatcgtccagctcaccaaac
agacgaccatccagtgcgccatctagcaaacacagcgcaacggcggctttggcaaatggc
gacggcttcgtagcaaatcatatgcccgtaacagtggcttcgaggtcatccgccgctgcc
gacgccgcctccctttccgatcgccgaccttcaagcgccaagccgaaacttttgaggtcg
aagagtgactttgtcctgcattcagatgatggctatgacagcgaccccgacaactcggac
gttgaccaccatcgccggcaaggcaataataccaagggcaaaaagataagctcatggggt
gcccggcatggcttcggggaccactacgattccgaggaaatatcacatctggtaaataat
tggtacatgtactttactgaaaagcgtcatgagacaacgggaaagccaaaactggcaccc
ttcgagatacaagattggcgaatgagggatcgactcaagactgtgtcggcggctattgcc
gtgtgtcttaacattggtgttgaacctccagatcagctaaagacaaaccccggagctaaa
atggaagcatggcaagacccgactgttactccggcccagaaagcgctcgaaaatatcggc
aaggctctgcagtcccaatatgagacgctggctatgcgtacgcgctacaagcagtatctt
gatccctcggtcgaggataccaagaaattctgcctctcgcttagaaagagcgccaaggac
gagcgtgttcttctccactacaacggtcatggtgtcccaaaacctacctcatccggtgag
atatgggtgttcaacaagaactatacacagtacattccagtctcactttatgatcttcaa
cattggttgcaagcgccgacaatcttcgtctgggattgctccgaggccggcaatatcctc
agcaactaccacaaatttgtcgagaaacatgaaaaggaagaggatgaggctgtcctacgt
gacccaaaccattacaaagcgaacttccgcccctatatccaccttgccgcttgcagctcc
tcacagaacctccccacaaatcctttacttcctgccgacttatttacatgctgcctcacg
acgccgatcgagatggctctgtggttcttcgtcctccagaacccgctacagaccggactc
acgcccgagagagccaagaagcttccagggcgtcttcaagagagacggacacctctcggg
gaactcaactggatttttacagccataactgacacaatcgcatggacgactcttccacgc
cacttattccgcaagttcttcagacaggacttgatggttgcggctctgttccgtaatttc
ttacttgcccagcgggtcatgtctgtgtacggctgtactccgcagtcctttccggagctg
ccagacacgaggcagcaccctctctgggagagctgggatcttgctgttgaccaggccctg
tctcagctgcccatgcttgagcgcaaggaaaccgagggtatcgagtacgagtatcaaaat
tcgacgttcttcaccgagcagctgactgcgttcgatgtctacttgacgcgtggcgacgca
ttgcaacaaaagccccctgagcagcttccggtggtgctacaagttctactcagtcaacag
catcgagtcagggcgctgatattattgggaagatttttggatctcggaccctgggcagtg
caactggcactaagcataggcatatacccctacgtattgaagctacttcaatccgctgcc
gccgagctgaagcctgtcatggtcttcatttggacacgggtactggctgtcgatacttcg
tgccagcaggatcttatcaaggatagcggctaccaatacttctccaacatcctcaagccg
tcagagggattgccagtcgctaacagcgatgagcacaaggccatgtgcgccttcattctg
gcaatgctctgcaaggggtacaagcctggccaagtcgtttgcaatcaaactgacatcatg
ggttactgtctttaccacatccttaatgaggataatccgcttctgaggcagtggtcttgc
ctctgcataagccaactgtggtacgatctcccggaggctaaatggcgaggtatcagagac
aatgcgccagccagattgtcgattctgacaaaggatggctgttctgaagttcgtgctgca
gtcctgtacgccatgactaccttcctgggtatacctgacctcacagacgaggttgccagg
atagaagagtcaattgcatggactgtgcttgacatggccaacgacggaagcccaatggtc
cgcaaggaactactggtgttcttctctcatttcattcttcgatatgagagcaagttccta
gtcgctgcatatgaacacctcctcgaagagaaggagtacttggcctacccaccgcatgat
gacggccgcgaaaacaagatgggtctgcattactcaagaccggacaagcgcggtcaggac
gggagcgaccgtgccaaatcacagggtctctcccacaacactatcattgctgccgtttgg
aaacacgtcaacatactcagtgttgatcctcatccggaagtccagagccatgcaacaacc
atagtcgactatgtacactacactctcttgcaatcatcattgggttcacaatcgcagagc
ctcatggacgacgttggacgacgagcaaggcggcaggcagccaggcagcaagcccaggca
agtcagagaaatagcattaatggcgggaatagcgttggggcaaccacacctttgccatca
ccgggtctccttcgtcgaaccgtgagcactctgttctctcccttctttccagtggatggt
ccaacaacacccacaactcccgagccctcccctggcctgtatcgaacatcgtctgtaaag
agtcggaagggagcagaaccagtggtgccagtatcaacgcagcacaacgatcatgatgtc
agtcatgccagctatcacgttgccagggagccagtttctgctggcttccaggatcgtgat
gttactcaagccccgaagctccctttgcaaagcacgctactggcttggtccatcgagtac
ttcctggagccacagatgaagtcgagtgaatccgaggagcctggaagcaccgagtataat
gagcgactgtggcgacgatcaaggaatgaaggcatcttgaatgagactcagccccaaaag
ttgcaggccggacgtcacaagtggaacaatcagactggaattttcaatacgcatgcgcag
ccgtcaaagctgaacttccatcagttcgaggatcatgttgccgtagcggatgacggcaac
acgattcagatctgggactggaagaaccaaggcaggctttcacggttctccaatggcaat
ccggagggctcacgcatcagtgatatgaaatttatcaacgaagaggatcaggcgctgctc
atgacagggtcttcggatggcgtgatccgcatctaccgcaattatgatagccatgacgat
gtcgaattgtcatcatcttggcgtgccctcaccgatatggttcccagtaatgttaactct
gggatggtttttgactggcagcaagtcaacggcacgacactagtggcgggcgatgttcgc
gtcattcgagtctggagcgcgggccaagaggcctgcgtgaccgatatccccgcccggtct
ggatcctgcgtcacttccctgacatccgaccagatgactgggaatgttttcgtcgctggt
tttggcgacggggctgtgagggtattcgacattcgactccgcccacaggatagcatgatt
agaaaatggaaagacgaaacagacagagtgtggatcaagacggtcgcgatgcaaaggggc
ggacagagggaactgatgagcgcaagccggaacggcaaagtcaagctgtgggatatacgt
atggataagccgctgagtgtgttccagacgacgaaggagacactcaggacagcgagcatg
cacgagcatctgcccgtattctctgttggaacttcggcacatacggtaaaggtatttaac
ctcgatggcaaggagctttcccagatggagccgtactccagcttccttcaaaatcgcggc
tcgcctatctcggcaacagcattccatccgcaccatgcgatcttaggctgtgcggcacgc
ggcgatcaccatgtcaacctttaccagtgctctggggcccggattccccaggcagacgaa
aagggagatgcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system