KEGG   Magnaporthe oryzae: MGG_02954Help
Entry
MGG_02954         CDS       T01027                                 

Definition
dolichyl-phosphate-mannose-protein mannosyltransferase 1
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
mgr  Magnaporthe oryzae
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:mgr00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 997 aa AA seqDB search
MARQAVAKAAPAPMRAETPPIDKGGNKVAQKPKNKPKSKSSTDYTSEGVEDNDVFLLPIS
DYQWMFAITALAAAVRLFRIYQPTSVVFDEVHFGGFASKYIKGRFFMDVHPPLAKLLITL
AGWLAGFDGNFDFKEIGKDYLEPKVPYVAMRMFPAICGILLAPTMFLTLKALGCRTIIAS
MGAGLIIFENGLLTQARLILLDSPLMITTAFSVLAFVSFTNQHEQGPSKAFGPSWWFWLA
MTGLGLGANFSVKWVGLFTIAWVGALTLVQLWVLLGDTKNVTMKTFYKHFLARAVCLIMI
PAGVYMGMFAIHFLCLVNPGEGDGFMSSEFQSTLNSKGMQDVPADVLMGSRVAIRHLNTQ
GGYLHSHPLMYPTGSKQQQITLYPHKDENNLWFLENQTQPVDANGVQINGTNAWDKVTPL
PYIQDGAVIRIYHIATHRRLHSHDVRPPVTEAEWQNEVSAYGYEGFDGDANDFFRVEIVK
KKSAKGAAQDRLRTLETKFRLVHVMTGCVLFSHKVKLPEWASEQQEVTCARGGTLPNSLW
YIESNEHAQLNETAERVNYRNPGFLGKFIELNTVMWKTNAGLVESHAWDSRPDSWPLLKR
GINFWGKERRQIYLIGNPVVWWSSTLAVVIYAVFKGIAVLRWQRNYKDYNNVVFKRFDYE
IGSSVLGWALHYFPFYLMQRQLFLHHYFPALYFAIMAWCQVMDFSLSRFRGFGIRENPII
VRAAAVGFLAISIVAFLLLSPLAYGNTWTRPECQRVKLLSGWDFDCNAFPDTYEAYQITT
PQNPVVAQTPQQSVNAQPPPPQMKPKEDGGEKKDINQDQQQAVISGAPNPALAVDNSEVL
PGGQRVLSREERVEYRDDKGNLLNEEQVKALQGKVEFKTRYETRTRVVDDQGNEILNAVI
PPQAEEPKQPVVEAPPAPKNDGPKDPVNPAGVAPPHPDVEGADKSTKQPVKDVAAESLVK
DETLSQDGTKEKEQSKAKPASENNEATGASSAAAPAS
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atggctcgccaggctgtcgcaaaggcggctcccgccccgatgcgggcggaaacaccgccg
atcgacaagggcggcaacaaggtcgcacagaagcccaaaaacaagcccaagtccaaatcc
tcgaccgactacacatccgagggcgtcgaggataacgatgtgttcctgctgcccatctcc
gactaccagtggatgtttgccatcactgcgttggccgctgccgtgcgcctgttccggata
taccaacctacaagtgtcgtcttcgacgaggtccacttcggtggtttcgcttccaagtat
atcaagggccgcttcttcatggatgttcacccacctttggccaagcttctgatcactttg
gccggctggttggccggttttgatggcaactttgacttcaaggagattggaaaggactac
cttgaacccaaggtcccatacgtcgcgatgcgcatgttccctgccatttgcggtattctg
ctggcccccactatgttcctcaccctgaaggccctcggctgccggactataatcgcctct
atgggtgccggcttgatcatctttgagaacggtctcctcacccaggctcggttgatcctg
ctcgattcgccccttatgatcaccactgcctttagcgtcctcgcctttgtttcattcact
aatcagcacgagcagggtcccagcaaggctttcggcccaagctggtggttctggctggca
atgaccggtcttggtctgggagccaacttcagcgtcaagtgggttggtctctttaccatt
gcctgggttggagccctgactttggttcagctgtgggttcttctcggcgacacgaagaac
gtgactatgaaaaccttctacaagcatttcttggctcgcgctgtctgtctcatcatgatc
cccgcgggtgtctacatgggcatgttcgccatccacttcctgtgcctggtgaaccccggc
gagggagatggtttcatgagctccgagttccagtccaccctgaactccaagggcatgcaa
gatgtgcccgccgacgtcctgatgggcagccgtgtcgcaatccgccatcttaacacccag
ggtggctacctccactctcacccccttatgtaccccaccggcagcaagcagcaacagatc
accctgtacccccacaaggacgagaacaacttgtggttcttggagaaccagactcagccc
gtggatgccaacggtgtgcagatcaacggcaccaacgcatgggacaaggtcactcctctc
ccgtatatccaggatggcgccgtcatccgtatttatcacatcgctacgcatcgccgcctg
cactctcacgatgtccgccccccggtcacagaggccgagtggcagaacgaggtttcggcc
tacggttacgagggctttgacggtgatgccaatgacttcttccgtgtagaaattgtcaag
aagaagtcggccaagggcgctgcccaggatcgcctgcgcactcttgagaccaagtttagg
ctggtgcacgtgatgactggatgtgttctcttctcccacaaggtcaaacttcctgagtgg
gcgtcagagcagcaggaggtcacatgcgcgcgtggtggaaccctgccaaacagcttgtgg
tacattgagtccaacgagcacgcgcagctgaacgaaaccgccgagagggtcaactaccgc
aaccctggcttcttgggcaagtttatcgagcttaacactgtcatgtggaagaccaacgcc
ggtctggtcgagtctcacgcctgggactctcgccctgactcgtggccgctgttgaagcgc
ggaatcaacttttggggcaaggagcgccgccagatctacctcatcggcaaccccgtcgtc
tggtggagctcgactcttgccgttgttatctacgccgtcttcaagggcattgctgtcctc
cgctggcagcgcaactacaaagactacaacaacgtcgtattcaagcgattcgactacgag
atcggatcctctgtcttgggatgggctctgcactacttccccttctacttgatgcagcgt
cagctcttcctgcaccactacttccctgctctgtactttgccatcatggcttggtgccag
gtcatggactttagcttgagcaggttccggggtttcggtatccgcgagaaccctattatt
gtcagggcagctgccgtcggcttcctggcaatctccatcgtggcattcttgctcttatcc
cctcttgcctatggtaacacttggactaggcccgagtgccagcgcgtcaagcttctgagc
ggctgggactttgactgcaacgcattccctgatacctacgaggcctaccagatcaccact
cctcagaacccggttgttgcgcagactccgcaacagtcggtaaacgcgcagccgccgccc
ccgcagatgaagcccaaggaggacggcggcgagaagaaggacatcaaccaagaccagcaa
caggcggtgatctcgggagctcccaacccggctctggcagtcgacaacagcgaggtgctc
ccgggcgggcagcgggtgctctcgcgggaggagcgggtcgagtaccgagacgacaagggc
aacctgctcaacgaggagcaggtcaaggccctgcagggcaaggtcgagttcaagacgcgc
tacgagacgcggacgcgcgtcgtcgacgatcaagggaacgagattctcaacgccgtgatt
cctccccaggccgaagagcccaagcagccggtggtggaggctccccccgcgccaaaaaac
gatgggcccaaggaccccgtaaacccggctggcgtcgccccgcctcaccctgatgttgag
ggcgccgacaagagcaccaagcagcccgtcaaggacgtcgccgccgagagcctggtcaag
gacgagaccctcagccaggacgggaccaaggagaaggagcagagcaaggccaagcccgcc
agcgagaataatgaggctaccggtgccagctccgctgctgctcctgcttcgtag

DBGET integrated database retrieval system