KEGG   Magnaporthe oryzae: MGG_03094Help
Entry
MGG_03094         CDS       T01027                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mgr  Magnaporthe oryzae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MGG_03094
   01230 Biosynthesis of amino acids
    MGG_03094
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGG_03094
   00051 Fructose and mannose metabolism
    MGG_03094
   00562 Inositol phosphate metabolism
    MGG_03094
Enzymes [BR:mgr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MGG_03094
Exosome [BR:mgr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MGG_03094
  Exosomal proteins of bladder cancer cells
   MGG_03094
  Exosomal proteins of melanoma cells
   MGG_03094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 254 aa AA seqDB search
MSTPSPPRRIVGVSTKMYFSAARTSSYITSLLSLLPSVPSNTDVFVIPDHVTLLPSIQQL
RAASSPILPGAQDCYSEDAGAYTGEVSPAVLAEVGCRIVELGHAERRRLFAETDASTAAK
AAAVVRNGMIPLVCVGETARQAEISAAVADVAGQVQAVMAAVPGSAEVVLAYEPVWAIGA
AQPAAAEYVVSVARGIRELECVRAREGTVRILYGGSAGPGLFEKLKDGVDGLFLGRFAHD
PEQFVRTIREVSEA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtccacaccctcaccaccccgccgcatcgtcggcgtatcaacaaagatgtacttctcc
gccgcccgcacctcctcttacatcaccagcctcctctccctgctgccttccgtcccctca
aacaccgacgtcttcgtcatcccggaccacgtcaccctgctcccctccatccagcagctc
cgcgccgcctcctccccgatcctcccgggcgcccaggactgctactcggaagacgccggc
gcgtacacgggcgaggtgtcccccgccgtgctggccgaggtgggctgccgcatcgtcgag
ctgggccacgcggagcgccggcggctctttgccgagaccgacgctagcaccgccgccaag
gccgccgccgtcgtgcgcaacggcatgatcccgctcgtgtgcgtcggcgagaccgcgcgc
caggctgaaatctcggccgccgtggccgacgtcgccggccaggtccaggccgtcatggcc
gcggtccccggcagcgcagaggtcgtgctcgcctacgagcccgtctgggccatcggggcc
gcgcagcccgccgcggcagagtacgtggtctcggtggcgcgcgggatccgggagctggag
tgcgtgcgggccagggagggcacggtcaggatactgtacggtgggagcgccgggccggga
ctgtttgagaagctcaaagatggggtggacgggctgttcctgggcaggttcgcgcacgac
ccggagcagtttgtccggacgattcgggaagtgtccgaggcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system