KEGG   Magnaporthe oryzae: MGG_03149Help
Entry
MGG_03149         CDS       T01027                                 

Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mgr  Magnaporthe oryzae
Pathway
mgr00020  Citrate cycle (TCA cycle)
mgr00310  Lysine degradation
mgr01100  Metabolic pathways
mgr01110  Biosynthesis of secondary metabolites
mgr01130  Biosynthesis of antibiotics
mgr01200  Carbon metabolism
Module
mgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mgr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MGG_03149
  Amino acid metabolism
   00310 Lysine degradation
    MGG_03149
Enzymes [BR:mgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MGG_03149
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H Trypan_PARP MIP-T3 CCDC53 RR_TM4-6 DUF4551
Motif
Other DBs
NCBI-GeneID: 2676735
NCBI-ProteinID: XP_003716846
UniProt: G4NAT5
Position
4
AA seq 421 aa AA seqDB search
MFSRRLITAARLVPVSQATSQPLRRFPLHRHFQHVRTYADQVVKVPQMAESISEGTLKQF
TKQVGDFVEQDEELATIETDKIDVAVNAPAAGTIKELLASEEDTVVVGQDLIRLELGGAP
AEGAEKKSEKPQETQAEKKPEPKEESKPEPTKKEEPAPSKKQESAPQPEKKETKQPAKES
SPATLGNREERRVKMNRMRLRTAERLKQSQNTAASLTTFNEVDMSSLMEFRKLYKDDVMK
KTGVKLGFMSAFSRAAVLAMRDIPAVNASIEGPNGGDTIVYRDYVDISLAVATEKGLVVP
VVRNTESMDMITIEKSIAEMGAKARAGKLTIEDMAGGTFTISNGGVFGSLMGTPIINLPQ
TAVLGLHAIKDRPVVVNGKIEIRPMMYLALTYDHRLLDGREAVSFLVKIKEFIEDPRRML
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgttctcccgaagacttataacggcggcgcgccttgtgcccgtcagccaagcaaccagc
cagccattgcgccgttttccgcttcacaggcatttccagcatgtacgcacatatgccgat
caggtcgtcaaggtgcctcagatggccgagtccatttccgagggtaccctgaagcagttc
acaaagcaggttggcgactttgttgagcaggatgaggagcttgcaaccattgagaccgac
aagatcgacgttgctgtcaatgccccagccgccggcactatcaaggagcttcttgcaagc
gaggaggataccgtcgttgttggacaggacctcatcaggttagaacttggtggtgcgccg
gcagagggagctgagaagaagtccgagaagcctcaggagacgcaggctgagaagaagccc
gagcccaaggaggagtcaaaacccgagcctaccaagaaggaggagcctgcaccctctaag
aaacaggagtctgctccccagcccgagaagaaggagaccaagcagcctgcaaaggagtca
tcgcctgctacactgggcaaccgcgaggagcgcagggtcaagatgaaccgcatgcgcctc
cgtaccgccgaacgcctcaagcagtcgcagaacactgccgcctccctgactacattcaac
gaggttgacatgtcttcgctgatggagttcaggaaactgtacaaggacgatgtgatgaag
aagacgggtgtcaagctcggattcatgagtgctttctcgcgtgctgccgttctcgccatg
cgtgacatccctgccgtcaacgcctcaattgagggccccaacggtggtgacaccattgtt
taccgcgactacgtcgacatcagccttgccgttgccactgagaagggtctcgttgtccct
gttgtgcgcaacaccgagtcaatggacatgatcaccattgaaaagtcgattgctgagatg
ggtgcaaaggcccgtgccggcaagcttaccattgaggatatggccggtggtactttcacc
atcagtaacggcggtgtctttggttctctgatgggtacacctattatcaaccttcctcag
accgctgtccttggtctgcatgccatcaaggaccggcccgtggttgtcaatggcaagatt
gagattcgcccaatgatgtacctcgccttgacctacgaccaccgtctgcttgatggcagg
gaagccgtgtcgtttttggtcaagatcaaggagttcatcgaggatccccgccgcatgctc
ttgtaa

DBGET integrated database retrieval system