KEGG   Magnaporthe oryzae: MGG_03149Help
Entry
MGG_03149         CDS       T01027                                 

Definition
dihydrolipoyllysine-residue succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mgr  Magnaporthe oryzae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:mgr01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mgr00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:mgr00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 421 aa AA seqDB search
MFSRRLITAARLVPVSQATSQPLRRFPLHRHFQHVRTYADQVVKVPQMAESISEGTLKQF
TKQVGDFVEQDEELATIETDKIDVAVNAPAAGTIKELLASEEDTVVVGQDLIRLELGGAP
AEGAEKKSEKPQETQAEKKPEPKEESKPEPTKKEEPAPSKKQESAPQPEKKETKQPAKES
SPATLGNREERRVKMNRMRLRTAERLKQSQNTAASLTTFNEVDMSSLMEFRKLYKDDVMK
KTGVKLGFMSAFSRAAVLAMRDIPAVNASIEGPNGGDTIVYRDYVDISLAVATEKGLVVP
VVRNTESMDMITIEKSIAEMGAKARAGKLTIEDMAGGTFTISNGGVFGSLMGTPIINLPQ
TAVLGLHAIKDRPVVVNGKIEIRPMMYLALTYDHRLLDGREAVSFLVKIKEFIEDPRRML
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgttctcccgaagacttataacggcggcgcgccttgtgcccgtcagccaagcaaccagc
cagccattgcgccgttttccgcttcacaggcatttccagcatgtacgcacatatgccgat
caggtcgtcaaggtgcctcagatggccgagtccatttccgagggtaccctgaagcagttc
acaaagcaggttggcgactttgttgagcaggatgaggagcttgcaaccattgagaccgac
aagatcgacgttgctgtcaatgccccagccgccggcactatcaaggagcttcttgcaagc
gaggaggataccgtcgttgttggacaggacctcatcaggttagaacttggtggtgcgccg
gcagagggagctgagaagaagtccgagaagcctcaggagacgcaggctgagaagaagccc
gagcccaaggaggagtcaaaacccgagcctaccaagaaggaggagcctgcaccctctaag
aaacaggagtctgctccccagcccgagaagaaggagaccaagcagcctgcaaaggagtca
tcgcctgctacactgggcaaccgcgaggagcgcagggtcaagatgaaccgcatgcgcctc
cgtaccgccgaacgcctcaagcagtcgcagaacactgccgcctccctgactacattcaac
gaggttgacatgtcttcgctgatggagttcaggaaactgtacaaggacgatgtgatgaag
aagacgggtgtcaagctcggattcatgagtgctttctcgcgtgctgccgttctcgccatg
cgtgacatccctgccgtcaacgcctcaattgagggccccaacggtggtgacaccattgtt
taccgcgactacgtcgacatcagccttgccgttgccactgagaagggtctcgttgtccct
gttgtgcgcaacaccgagtcaatggacatgatcaccattgaaaagtcgattgctgagatg
ggtgcaaaggcccgtgccggcaagcttaccattgaggatatggccggtggtactttcacc
atcagtaacggcggtgtctttggttctctgatgggtacacctattatcaaccttcctcag
accgctgtccttggtctgcatgccatcaaggaccggcccgtggttgtcaatggcaagatt
gagattcgcccaatgatgtacctcgccttgacctacgaccaccgtctgcttgatggcagg
gaagccgtgtcgtttttggtcaagatcaaggagttcatcgaggatccccgccgcatgctc
ttgtaa

DBGET integrated database retrieval system