KEGG   Magnaporthe oryzae: MGG_03186Help
Entry
MGG_03186         CDS       T01027                                 

Definition
1,4-alpha-glucan-branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mgr  Magnaporthe oryzae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MGG_03186
Enzymes [BR:mgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MGG_03186
Exosome [BR:mgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MGG_03186
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 691 aa AA seqDB search
MATNGSNTVVANEGTVEHIGAVKLDPWLEPFEDVIKRRHGMAEDWLKKIEQSEGSIEKFT
RGTEVYGFNVKPDNTIVYREWAPNATAAFLVGDFNQWSRQSHPMKKNEYGVFEITVPPTA
AGEPAIPHNSKVKISLFLPNGQLIDRLPAWIKYVTQDLSVSPAYDARFWNPPSSERYTFK
NPRPKKPKSVRVYEAHVGISSPELRVATYKEFTKNMLPRIKKLGYNVIQLMAIMEHAYYA
SFGYQINNFFAASSRYGTPEDLKELIDAAHGMGLTVLLDVVHSHASKNVLDGINEFDGTD
HQYFHAGGKGRHDQWDSRLFNYGHHEVLRFLLSNLRFWMDEYQFDGFRFDGVTSMLYLHH
GMGTGFSGGYHEYFGPDADEEALVYLMLANKMLHELYPEVISIAEDVSGMPTLCLPWSDG
GVGFDYRLAMAIPDMWIKILKEKKDEEWDMADICWTLTNRRHGEKTIAYCESHDQALVGD
KTLMMHLCDAEMYTHMSTLTPLTPIIDRGMALHKMIRLLTHGLGGEGYLNFEGNEFGHPE
WLDFPREGNQNSFWYARRQLNLTEDNLLRYRFLNDFDAAMNNCEEKHGWLSAPQAYISLK
NESDMVVVFERAGVVFAFNFHPTQSFADYRIGVDVSGTYKVALTTDDKEFGGHGRIDSST
RFFTTPMEWNGRKNWTHIYLPSRTAVVLELE
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggctaccaatggatccaatacggtggtggccaacgaaggtacagttgagcacattggc
gctgtaaagcttgacccctggctcgaacccttcgaggatgtcatcaaacgccgccatggc
atggctgaagactggctcaagaagatcgagcagagcgaagggtcaattgagaagtttacg
aggggcaccgaggtttacggattcaatgtgaagccagacaacacaatcgtgtatcgtgaa
tgggccccaaatgcaactgcggcattcctggttggtgacttcaaccaatggagccgccag
tcgcaccctatgaagaagaatgagtatggagtcttcgagataaccgttccccccactgcc
gctggagaaccagctattcctcacaactccaaggttaagatctcccttttcctccccaat
gggcaactcatagatcgccttccggcgtggatcaagtatgtcacgcaggatctctctgta
tcgcctgcctacgacgccaggttctggaatcccccatccagtgagaggtatacattcaag
aaccctcgccccaagaagcccaagagcgtgcgtgtctacgaggcccatgttggaatttcc
tcgcctgagcttcgtgtagccacatacaaggagttcaccaagaacatgctccctcgcatc
aagaagcttggatacaacgtcatccaacttatggccattatggagcatgcttactatgcc
agctttggctaccagatcaacaacttctttgccgcaagcagccgctatggcaccccggag
gatcttaaggagcttattgacgctgctcatggcatgggacttactgttctgcttgatgtg
gttcacagccacgcgtccaagaacgtcttggatggcatcaatgagtttgacgggacagac
catcagtacttccatgcaggcggcaaagggagacacgaccagtgggacagcaggctgttc
aactacggccatcatgaagttcttcgattcctcctcagcaatctccgattctggatggac
gagtatcagttcgatggcttccgttttgacggcgtgacaagcatgctgtatctccaccac
ggcatggggactggcttctctggaggctaccatgagtatttcggcccggatgccgacgaa
gaggctctcgtgtatctcatgcttgcaaacaagatgcttcatgagctgtaccccgaggtg
atttccatcgcagaggacgtctctggcatgccaactctctgtcttccttggtccgacggc
ggagtgggcttcgattatcgtctagccatggcaatcccagacatgtggatcaagatcctc
aaagagaagaaagatgaggaatgggacatggccgatatttgctggacattgaccaacaga
cggcacggcgagaagaccattgcgtactgcgagagtcacgatcaagcacttgtcggtgac
aagactctcatgatgcatctctgcgacgctgagatgtacacccacatgtcaacactgaca
cctttgacccctatcattgaccgcgggatggctttgcacaaaatgattcgcctgctcact
catggtcttggaggcgagggttacctcaacttcgagggtaacgagtttgggcaccccgag
tggcttgacttccctcgcgagggcaaccagaactcattctggtatgcaaggcgtcaattg
aacctgaccgaggacaatcttttgagatatcggttcctaaacgacttcgacgccgccatg
aacaactgcgaggagaagcacggctggctcagtgctccccaggcgtacatttcgctcaaa
aacgagtctgatatggtagtcgtctttgaacgtgcaggtgtggtattcgctttcaacttc
cacccaacccagagctttgccgattacagaattggagtcgacgtgtctggcacgtacaag
gtcgctttgaccacggacgacaaagaattcggaggccatggtcgtatagacagctccaca
cgattcttcaccaccccgatggagtggaacggtcgcaagaactggactcatatctatctt
cccagccgtaccgctgtcgtcctcgagctggagtag

DBGET integrated database retrieval system