KEGG   Magnaporthe oryzae: MGG_03186Help
Entry
MGG_03186         CDS       T01027                                 

Definition
(RefSeq) 1,4-alpha-glucan-branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mgr  Magnaporthe oryzae
Pathway
mgr00500  Starch and sucrose metabolism
mgr01100  Metabolic pathways
mgr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MGG_03186
Enzymes [BR:mgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MGG_03186
Exosome [BR:mgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MGG_03186
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase hDGE_amylase GHL6
Motif
Other DBs
NCBI-GeneID: 2676993
NCBI-ProteinID: XP_003716803
UniProt: G4NAD9
Position
4
AA seq 691 aa AA seqDB search
MATNGSNTVVANEGTVEHIGAVKLDPWLEPFEDVIKRRHGMAEDWLKKIEQSEGSIEKFT
RGTEVYGFNVKPDNTIVYREWAPNATAAFLVGDFNQWSRQSHPMKKNEYGVFEITVPPTA
AGEPAIPHNSKVKISLFLPNGQLIDRLPAWIKYVTQDLSVSPAYDARFWNPPSSERYTFK
NPRPKKPKSVRVYEAHVGISSPELRVATYKEFTKNMLPRIKKLGYNVIQLMAIMEHAYYA
SFGYQINNFFAASSRYGTPEDLKELIDAAHGMGLTVLLDVVHSHASKNVLDGINEFDGTD
HQYFHAGGKGRHDQWDSRLFNYGHHEVLRFLLSNLRFWMDEYQFDGFRFDGVTSMLYLHH
GMGTGFSGGYHEYFGPDADEEALVYLMLANKMLHELYPEVISIAEDVSGMPTLCLPWSDG
GVGFDYRLAMAIPDMWIKILKEKKDEEWDMADICWTLTNRRHGEKTIAYCESHDQALVGD
KTLMMHLCDAEMYTHMSTLTPLTPIIDRGMALHKMIRLLTHGLGGEGYLNFEGNEFGHPE
WLDFPREGNQNSFWYARRQLNLTEDNLLRYRFLNDFDAAMNNCEEKHGWLSAPQAYISLK
NESDMVVVFERAGVVFAFNFHPTQSFADYRIGVDVSGTYKVALTTDDKEFGGHGRIDSST
RFFTTPMEWNGRKNWTHIYLPSRTAVVLELE
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggctaccaatggatccaatacggtggtggccaacgaaggtacagttgagcacattggc
gctgtaaagcttgacccctggctcgaacccttcgaggatgtcatcaaacgccgccatggc
atggctgaagactggctcaagaagatcgagcagagcgaagggtcaattgagaagtttacg
aggggcaccgaggtttacggattcaatgtgaagccagacaacacaatcgtgtatcgtgaa
tgggccccaaatgcaactgcggcattcctggttggtgacttcaaccaatggagccgccag
tcgcaccctatgaagaagaatgagtatggagtcttcgagataaccgttccccccactgcc
gctggagaaccagctattcctcacaactccaaggttaagatctcccttttcctccccaat
gggcaactcatagatcgccttccggcgtggatcaagtatgtcacgcaggatctctctgta
tcgcctgcctacgacgccaggttctggaatcccccatccagtgagaggtatacattcaag
aaccctcgccccaagaagcccaagagcgtgcgtgtctacgaggcccatgttggaatttcc
tcgcctgagcttcgtgtagccacatacaaggagttcaccaagaacatgctccctcgcatc
aagaagcttggatacaacgtcatccaacttatggccattatggagcatgcttactatgcc
agctttggctaccagatcaacaacttctttgccgcaagcagccgctatggcaccccggag
gatcttaaggagcttattgacgctgctcatggcatgggacttactgttctgcttgatgtg
gttcacagccacgcgtccaagaacgtcttggatggcatcaatgagtttgacgggacagac
catcagtacttccatgcaggcggcaaagggagacacgaccagtgggacagcaggctgttc
aactacggccatcatgaagttcttcgattcctcctcagcaatctccgattctggatggac
gagtatcagttcgatggcttccgttttgacggcgtgacaagcatgctgtatctccaccac
ggcatggggactggcttctctggaggctaccatgagtatttcggcccggatgccgacgaa
gaggctctcgtgtatctcatgcttgcaaacaagatgcttcatgagctgtaccccgaggtg
atttccatcgcagaggacgtctctggcatgccaactctctgtcttccttggtccgacggc
ggagtgggcttcgattatcgtctagccatggcaatcccagacatgtggatcaagatcctc
aaagagaagaaagatgaggaatgggacatggccgatatttgctggacattgaccaacaga
cggcacggcgagaagaccattgcgtactgcgagagtcacgatcaagcacttgtcggtgac
aagactctcatgatgcatctctgcgacgctgagatgtacacccacatgtcaacactgaca
cctttgacccctatcattgaccgcgggatggctttgcacaaaatgattcgcctgctcact
catggtcttggaggcgagggttacctcaacttcgagggtaacgagtttgggcaccccgag
tggcttgacttccctcgcgagggcaaccagaactcattctggtatgcaaggcgtcaattg
aacctgaccgaggacaatcttttgagatatcggttcctaaacgacttcgacgccgccatg
aacaactgcgaggagaagcacggctggctcagtgctccccaggcgtacatttcgctcaaa
aacgagtctgatatggtagtcgtctttgaacgtgcaggtgtggtattcgctttcaacttc
cacccaacccagagctttgccgattacagaattggagtcgacgtgtctggcacgtacaag
gtcgctttgaccacggacgacaaagaattcggaggccatggtcgtatagacagctccaca
cgattcttcaccaccccgatggagtggaacggtcgcaagaactggactcatatctatctt
cccagccgtaccgctgtcgtcctcgagctggagtag

DBGET integrated database retrieval system