KEGG   Magnaporthe oryzae: MGG_03201Help
Entry
MGG_03201         CDS       T01027                                 

Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mgr  Magnaporthe oryzae
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MGG_03201
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGG_03201
   00620 Pyruvate metabolism
    MGG_03201
   00640 Propanoate metabolism
    MGG_03201
  Energy metabolism
   00680 Methane metabolism
    MGG_03201
Enzymes [BR:mgr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MGG_03201
Lipid biosynthesis proteins [BR:mgr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MGG_03201
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 669 aa AA seqDB search
MTPEASKAPVVAEAHEVDTYHPPQKMLDKHPSKPHIANLEEYQQLYKESISEPKQFWARM
ARELLTWSRDFETVYSGSLSAGDSAWFLEGELNASYNCIDRHALKDPNRVAIIYEADDPS
SGRTLTYGELMREVCRTAHVLRQMGVRKGDTVAVYLPMIPEALIAFLAVTRIGAVHSVVF
AGFSADSLRDRVVDGQSKVVITTDEGKRGGKLIGTKRIVDEALKNCPDVSHVLVYKRTGA
DVPMMQGRDFWWHEEVEKWPNYIPPVPMNSEDPLFLLYTSGSTGKPKGVMHTTAGYLLGA
AMTGKYVFDIHDGDRFFCGGDVGWITGHTYVVYAPLLLGVSTVVFEGTPAYPTFSRYWDI
IDQHKITHFYVAPTALRLLKRAGDQWVKHEMKHLRVLGSVGEPIAAEVWKWYFEIVGKEQ
AQIVDTYWQTETGSNVICPLAGVTPTKPGSASLPFFGIEPAIIDPVSGEEIHGNDVEGVL
GFKQAWPSMARTVWGAHKRYMETYMNVYNGFYFTGDGAARDHEGFYWIRGRVDDVVNVSG
HRLSTAEIEAALLEHHYVAEAAVVGIQDELTGQAVNAFVSLAEHVTTDNDESLRKELITQ
VRRSIGPFAAPKAVFVVPDLPRTRSGKIMRRILRKILAGEEDQLGDVSTLSDPTVVDRII
TTVHEYKKK
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgactcccgaagcttccaaggcgcccgttgtggcagaggcgcatgaagtcgacacttac
catcctccccagaaaatgcttgacaagcatcccagcaagcctcatatagccaacctcgag
gagtaccagcagctctacaaggagagcatctccgagcctaagcaattctgggcacggatg
gcacgagagcttttgacatggagtcgggatttcgaaacggtttactcggggagcctctct
gctggcgacagtgcctggttcctggagggcgagctcaacgcttcgtataactgcatcgac
aggcatgcgctcaaggatccaaaccgagtggccatcatatacgaggcggacgatccgagc
agcgggcgaaccctgacctacggcgagctgatgcgcgaggtttgcaggacagcacatgtt
ctccgtcagatgggtgttcgcaagggggacactgtagccgtgtaccttcccatgatcccc
gaggcgctcatcgcatttctggccgtcactcgcattggcgctgttcactccgttgtgttt
gcaggtttctcggctgactcgctgcgcgaccgcgttgttgatggccagtccaaggtcgtt
atcactactgacgagggcaagcgcggtggcaagctgattggtacaaagcgcatcgttgac
gaggccctgaagaactgcccagatgttagtcacgtgctggtttacaagaggacgggcgca
gatgtgcccatgatgcaggggcgcgatttttggtggcatgaggaggttgagaagtggcca
aactatatcccgcccgtccccatgaactcggaagatccactgttccttctgtacacgtcc
ggttctacaggcaagccaaaaggtgttatgcataccaccgccggctacctgttgggcgcc
gccatgacgggcaagtatgtcttcgacatccacgacggggatcgctttttctgcggcggt
gatgttggctggattactggacacacatatgtcgtttacgctcctctgcttctgggtgtt
tcaacggtcgtgttcgaaggcaccccagcgtacccaactttctctcgctactgggacatc
atcgaccagcacaagatcactcacttttacgttgccccgactgctctcaggctgctaaag
cgtgcaggagaccagtgggtcaagcatgaaatgaagcaccttcgggtcctgggctctgtc
ggagagcccattgcagccgaggtgtggaaatggtacttcgagatcgttggaaaggaacag
gcgcaaatcgtggacacctattggcaaacagagacgggctccaatgtcatttgccctctc
gcgggcgtcaccccaaccaaaccaggctctgcctcgctgcctttctttggcatcgaacct
gccatcattgatcccgtatctggtgaggagatccacggcaatgacgttgaaggagtgctt
ggtttcaaacaggcatggcccagcatggcgaggacagtgtggggtgcccacaagaggtat
atggagacttatatgaacgtttacaatggattctatttcactggagacggtgctgcacgg
gaccatgaagggttttattggatcagaggcagagtggacgacgttgttaacgtgagtggc
caccgactgtcaacagcggagattgaagccgcgctactcgagcatcattatgttgccgag
gctgccgttgtaggtatccaggacgagctcacgggtcaggcagtgaatgcatttgtgtcg
ctggccgagcatgttacaacggacaacgacgagtccctgaggaaggaactcattacccag
gttcggcgtagcattggcccctttgcggcacccaaagccgtgttcgtcgtcccagattta
ccacgcacaaggagtggtaagatcatgcggagaattctcaggaagatcctcgccggcgag
gaggaccagcttggcgatgtcagcactctttcggacccgacagtggttgatagaatcatc
acgaccgtccatgagtacaagaagaagtag

DBGET integrated database retrieval system