KEGG   Magnaporthe oryzae: MGG_03513Help
Entry
MGG_03513         CDS       T01027                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
mgr  Magnaporthe oryzae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 474 aa AA seqDB search
MSDNATAEISSRRSGRVRPEISYKERDDKDSYDELRRAQGYTVKRQRKDLSIKGHQNGIQ
KADEEADAVCTNQGPDLLDDVLNFPPEELEAYEGWVELESDPAHFNYILHTLGVSNVRSE
EIFSMDETEIAALRKPIYGFIFLFECEGVPISDEIVPPPSNMWFAAQTASNSCATVALLN
VLMNCDEVAMGEKVRKFKEETADMVLSHRGAYLSQNKFLRSTHNTFARRLDLMDADLGMM
NQWEERNKRQNKGKSGKRKRKALDPDSAKHYVGYIPHDGQLWELDGLDGGVICLGPYQGD
WACAVIPHIQRKVEELGLQANLLALSHNPQASVRQKLAANMACYEALLQKLAANPTLKSS
AEQDSSYITCKQEHAEQLEKIGLTYEEAVAIAAPQEFLKELDGPEMTPEHADTAMRRLIA
EQRDLRLQYDAARESGNEDLAAARRRCQDYTPLVHGWLRAMGEAGVLEALADSQ
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtccgataacgcaaccgctgagatcagtagccgtcgatcggggagagtacgacccgag
atctcgtacaaggagcgagacgataaggacagctatgacgaacttcgacgtgctcaagga
tacaccgtcaagagacagcgaaaagatctgtccatcaaaggccatcaaaacggaatccaa
aaagctgatgaagaggcagacgctgtttgcaccaatcaaggtccggacctccttgacgat
gtactcaactttccgcccgaggagttggaagcatacgagggctgggttgagcttgaatca
gatccggcacatttcaactacatactgcacacacttggcgtgtccaatgtccgtagcgag
gaaattttcagcatggatgagacagagatagcggcgctcagaaaaccaatctacggattt
atatttttattcgaatgcgagggggttccaatctcagacgagatagtcccccctccatcg
aatatgtggtttgccgcacagactgcctcgaattcgtgtgctacagttgccctgttgaat
gttttgatgaactgcgatgaagtagctatgggcgaaaaagtgcgtaagttcaaggaagaa
actgcagacatggtgctctcgcacagaggtgcatacttgtcccagaacaagtttctccgg
tcaacccacaacacatttgcgcgtcgtctcgacctcatggacgcagacttgggtatgatg
aatcaatgggaagagcgtaacaagcgccaaaacaagggaaagtccggcaagcgcaagcgc
aaggcccttgacccagactcagccaagcattacgtgggatatattcctcacgatggtcag
ctgtgggagctcgatgggttggatggaggtgtcatttgcttaggaccatatcagggggac
tgggcctgtgccgtgataccccatatccagagaaaggttgaagagcttggtctccaggcc
aacctactcgcactctcccacaatccccaagccagcgtgcgccagaagcttgcagcgaac
atggcctgctatgaggcactcctacaaaaattggctgccaatccaacactgaagagtagc
gcggagcaggattcaagttacatcacatgcaaacaagaacacgccgagcagttggaaaag
attggcctaacatacgaagaagctgtggcgatagcagcccctcaagaatttttgaaggag
ttggacggaccggaaatgacacccgagcatgcggatacagctatgaggaggttaatagct
gagcaacgtgatctgagactgcagtatgacgcagcccgggaaagcggtaacgaggatctc
gctgctgcgcgtcgccgatgtcaggactacactcctttggtccatggatggctgcgtgcc
atgggcgaagctggtgtactggaagcccttgcagattcgcaatag

DBGET integrated database retrieval system