KEGG   Magnaporthe oryzae: MGG_03578Help
Entry
MGG_03578         CDS       T01027                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
mgr  Magnaporthe oryzae
Brite
Exosome [BR:mgr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MGG_03578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 137 aa AA seqDB search
MPPKAADKKPASKAPATASKAPEKKDAGKKTAASGDKKKRTKTRKETYSSYIYKVLKQVH
PDTGISNRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGELAKH
AVSEGTKAVTKYSSSTK
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgccccccaaggccgctgacaagaagcccgcctccaaggccccggctactgcctccaag
gctcccgagaagaaggatgccggcaagaagactgccgcctctggcgacaagaagaagagg
accaagacccgcaaggagacttactcttcatacatctacaaggtcctcaagcaggtccac
cccgacactggtatctccaaccgtgccatgtccatcctgaactctttcgtcaacgacatc
ttcgagcgtgttgctaccgaagcttccaagcttgccgcctacaacaagaagtcaaccatc
tcatctcgtgagatccagacctcggtcaggcttatcttgcccggtgagcttgccaagcac
gccgtgtctgaaggtaccaaggctgttaccaagtactcttcaagcaccaaataa

DBGET integrated database retrieval system